Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9GGZ9

Protein Details
Accession A0A1B9GGZ9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
109-132LPVSVVKKEPPKKDPPPSENPFCSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 20.5, cyto_nucl 14, mito 2
Family & Domain DBs
Amino Acid Sequences MQAPKSGGYGGGDGIHGPLNPFVVTPPPIDDKEDEIPGYVKRFGAYPRDALRGADRIPTVTSAQHTLTEGVFLPAGTLLPKGASFAMQATIDFGLHFPKGTKVPGGFLLPVSVVKKEPPKKDPPPSENPFCSIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.09
4 0.09
5 0.09
6 0.1
7 0.1
8 0.1
9 0.09
10 0.12
11 0.13
12 0.13
13 0.16
14 0.19
15 0.2
16 0.23
17 0.23
18 0.24
19 0.26
20 0.27
21 0.23
22 0.2
23 0.2
24 0.19
25 0.21
26 0.17
27 0.14
28 0.12
29 0.14
30 0.16
31 0.21
32 0.21
33 0.24
34 0.26
35 0.29
36 0.29
37 0.29
38 0.28
39 0.25
40 0.23
41 0.21
42 0.18
43 0.15
44 0.15
45 0.16
46 0.14
47 0.12
48 0.13
49 0.11
50 0.12
51 0.12
52 0.12
53 0.11
54 0.1
55 0.09
56 0.09
57 0.07
58 0.06
59 0.06
60 0.05
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.05
69 0.05
70 0.05
71 0.05
72 0.06
73 0.08
74 0.07
75 0.07
76 0.08
77 0.08
78 0.08
79 0.07
80 0.07
81 0.07
82 0.08
83 0.08
84 0.08
85 0.11
86 0.13
87 0.14
88 0.18
89 0.16
90 0.18
91 0.21
92 0.23
93 0.2
94 0.18
95 0.18
96 0.14
97 0.17
98 0.16
99 0.14
100 0.13
101 0.17
102 0.27
103 0.34
104 0.42
105 0.47
106 0.56
107 0.64
108 0.74
109 0.8
110 0.78
111 0.81
112 0.81
113 0.82
114 0.75