Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B9GX63

Protein Details
Accession A0A1B9GX63    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
5-30RLYTKGRILGHKRGKRNSRPNQSLVQHydrophilic
NLS Segment(s)
PositionSequence
15-20HKRGKR
Subcellular Location(s) mito 16.5, mito_nucl 10, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MAATRLYTKGRILGHKRGKRNSRPNQSLVQIEGVDSKEAARHYLGKRIAYVYKAKREINGSRVRVIWGRVSRPHGNSGVVKSKFRVNLPAKVFGASCRIMLFPSTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.64
3 0.71
4 0.76
5 0.81
6 0.82
7 0.86
8 0.86
9 0.86
10 0.85
11 0.81
12 0.76
13 0.7
14 0.61
15 0.51
16 0.43
17 0.32
18 0.25
19 0.23
20 0.18
21 0.14
22 0.12
23 0.1
24 0.1
25 0.1
26 0.11
27 0.1
28 0.16
29 0.17
30 0.24
31 0.26
32 0.25
33 0.25
34 0.27
35 0.27
36 0.23
37 0.3
38 0.27
39 0.32
40 0.35
41 0.35
42 0.34
43 0.38
44 0.39
45 0.39
46 0.43
47 0.38
48 0.36
49 0.36
50 0.35
51 0.32
52 0.3
53 0.29
54 0.24
55 0.26
56 0.29
57 0.35
58 0.38
59 0.39
60 0.41
61 0.36
62 0.36
63 0.34
64 0.36
65 0.38
66 0.36
67 0.35
68 0.32
69 0.37
70 0.37
71 0.36
72 0.41
73 0.36
74 0.43
75 0.46
76 0.51
77 0.46
78 0.44
79 0.43
80 0.34
81 0.34
82 0.27
83 0.23
84 0.17
85 0.17
86 0.16