Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B9GYS2

Protein Details
Accession A0A1B9GYS2    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
53-81SPSPSPRKAQDQRKKTRRGSRGVSKRPRSBasic
NLS Segment(s)
PositionSequence
58-96PRKAQDQRKKTRRGSRGVSKRPRSSSSTPSPPPKVKVKV
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 4
Family & Domain DBs
Amino Acid Sequences MSINDDDIKPFISLLSSASPSPTSPPPPVPALTLTPTTDQTIPQPTDTVIPPSPSPSPRKAQDQRKKTRRGSRGVSKRPRSSSSTPSPPPKVKVKVKTEARPTVFNPSQRTEAVGKGGNSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.13
3 0.13
4 0.13
5 0.15
6 0.16
7 0.15
8 0.19
9 0.22
10 0.22
11 0.24
12 0.27
13 0.29
14 0.31
15 0.32
16 0.3
17 0.27
18 0.26
19 0.25
20 0.24
21 0.22
22 0.2
23 0.21
24 0.21
25 0.19
26 0.17
27 0.17
28 0.21
29 0.21
30 0.19
31 0.19
32 0.17
33 0.18
34 0.18
35 0.2
36 0.14
37 0.15
38 0.15
39 0.17
40 0.19
41 0.21
42 0.25
43 0.25
44 0.29
45 0.31
46 0.4
47 0.46
48 0.55
49 0.6
50 0.66
51 0.73
52 0.77
53 0.83
54 0.82
55 0.83
56 0.8
57 0.78
58 0.76
59 0.76
60 0.77
61 0.79
62 0.8
63 0.79
64 0.79
65 0.76
66 0.72
67 0.69
68 0.63
69 0.61
70 0.6
71 0.6
72 0.59
73 0.62
74 0.65
75 0.62
76 0.61
77 0.61
78 0.62
79 0.62
80 0.66
81 0.66
82 0.69
83 0.74
84 0.77
85 0.78
86 0.77
87 0.72
88 0.67
89 0.62
90 0.62
91 0.58
92 0.55
93 0.52
94 0.47
95 0.47
96 0.42
97 0.44
98 0.36
99 0.34
100 0.33
101 0.33