Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9GTH9

Protein Details
Accession A0A1B9GTH9    Localization Confidence High Confidence Score 17
NoLS Segment(s)
PositionSequenceProtein Nature
3-33SGVVSKKLKFKGDKPKKKKRSHHSSHGGAGEBasic
281-300ISEKDRRELKKARKEGKLAEBasic
NLS Segment(s)
PositionSequence
8-24KKLKFKGDKPKKKKRSH
284-298KDRRELKKARKEGKL
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR008999  Actin-crosslinking  
IPR010414  FRG1  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF06229  FRG1  
Amino Acid Sequences MSSGVVSKKLKFKGDKPKKKKRSHHSSHGGAGEDEGDDLAALAAADPRGWVFPENPMEISGPAFILLPSEPMTCLAWDPQRQRVYAAPIDLPQVPEGMNDLSEAEILQTIEPSDVNHVWVISRLSGSEDVVSLRTSTGTFLTASPSGTLSATTPSRGPLEAFIPLASSSSSSIFPEYTIQTQHNSKYLSTVPPTGAAIGKLKAELRVDADTPQKNETVRIKCQREFVYKARLAQQEAQDGSGVGRSNKKRLLEGGPSEGSIEDEMKKNREAQTWGGGRSIISEKDRRELKKARKEGKLAEAMLDRRAALKSDRYAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.79
3 0.82
4 0.88
5 0.9
6 0.93
7 0.95
8 0.94
9 0.94
10 0.93
11 0.93
12 0.92
13 0.87
14 0.83
15 0.76
16 0.67
17 0.55
18 0.45
19 0.35
20 0.25
21 0.18
22 0.11
23 0.07
24 0.05
25 0.05
26 0.04
27 0.04
28 0.03
29 0.03
30 0.05
31 0.05
32 0.05
33 0.05
34 0.06
35 0.07
36 0.08
37 0.1
38 0.09
39 0.16
40 0.21
41 0.23
42 0.23
43 0.24
44 0.24
45 0.23
46 0.22
47 0.16
48 0.11
49 0.09
50 0.09
51 0.07
52 0.07
53 0.07
54 0.08
55 0.09
56 0.09
57 0.09
58 0.11
59 0.12
60 0.11
61 0.11
62 0.14
63 0.19
64 0.25
65 0.28
66 0.35
67 0.38
68 0.38
69 0.39
70 0.38
71 0.39
72 0.35
73 0.34
74 0.26
75 0.24
76 0.26
77 0.25
78 0.22
79 0.16
80 0.14
81 0.11
82 0.1
83 0.11
84 0.09
85 0.08
86 0.07
87 0.07
88 0.06
89 0.06
90 0.06
91 0.05
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.05
98 0.06
99 0.06
100 0.09
101 0.09
102 0.1
103 0.1
104 0.09
105 0.09
106 0.11
107 0.11
108 0.08
109 0.08
110 0.07
111 0.09
112 0.09
113 0.1
114 0.08
115 0.08
116 0.08
117 0.08
118 0.09
119 0.07
120 0.06
121 0.06
122 0.06
123 0.07
124 0.06
125 0.07
126 0.07
127 0.07
128 0.1
129 0.1
130 0.1
131 0.09
132 0.09
133 0.09
134 0.08
135 0.08
136 0.06
137 0.09
138 0.09
139 0.09
140 0.09
141 0.1
142 0.1
143 0.1
144 0.1
145 0.09
146 0.09
147 0.1
148 0.1
149 0.08
150 0.08
151 0.08
152 0.08
153 0.06
154 0.06
155 0.06
156 0.07
157 0.07
158 0.07
159 0.08
160 0.08
161 0.08
162 0.1
163 0.11
164 0.1
165 0.12
166 0.12
167 0.14
168 0.17
169 0.18
170 0.2
171 0.2
172 0.18
173 0.2
174 0.21
175 0.22
176 0.21
177 0.22
178 0.18
179 0.18
180 0.18
181 0.16
182 0.14
183 0.12
184 0.12
185 0.11
186 0.1
187 0.11
188 0.11
189 0.12
190 0.13
191 0.12
192 0.14
193 0.15
194 0.15
195 0.17
196 0.23
197 0.24
198 0.25
199 0.25
200 0.24
201 0.23
202 0.28
203 0.33
204 0.33
205 0.39
206 0.47
207 0.51
208 0.52
209 0.58
210 0.59
211 0.58
212 0.58
213 0.54
214 0.54
215 0.51
216 0.51
217 0.52
218 0.49
219 0.46
220 0.45
221 0.43
222 0.4
223 0.38
224 0.35
225 0.27
226 0.25
227 0.21
228 0.18
229 0.16
230 0.12
231 0.2
232 0.22
233 0.28
234 0.33
235 0.34
236 0.34
237 0.38
238 0.43
239 0.43
240 0.44
241 0.44
242 0.4
243 0.38
244 0.36
245 0.31
246 0.25
247 0.18
248 0.16
249 0.12
250 0.17
251 0.21
252 0.23
253 0.25
254 0.29
255 0.32
256 0.36
257 0.37
258 0.36
259 0.42
260 0.44
261 0.43
262 0.39
263 0.35
264 0.29
265 0.29
266 0.29
267 0.24
268 0.25
269 0.3
270 0.31
271 0.39
272 0.47
273 0.46
274 0.52
275 0.57
276 0.63
277 0.68
278 0.76
279 0.77
280 0.78
281 0.81
282 0.79
283 0.79
284 0.75
285 0.65
286 0.6
287 0.57
288 0.5
289 0.45
290 0.39
291 0.3
292 0.25
293 0.25
294 0.23
295 0.21
296 0.27