Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9GJM7

Protein Details
Accession A0A1B9GJM7   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
21-43SEEKPSRSSRSRSRSRSSSKSVGHydrophilic
NLS Segment(s)
PositionSequence
25-70PSRSSRSRSRSRSSSKSVGSRSKSKSGRSGSSKGDGRSSSGSRRSS
230-281KPPEKPTEGEKKEEGEAAKPAGEEKKEEKPAEKKEEATKPAEGDKPKEEDKK
Subcellular Location(s) nucl 16, cyto_nucl 11.5, cyto 5, mito 4
Family & Domain DBs
Amino Acid Sequences MADDEEDETSSAGGSGDESGSEEKPSRSSRSRSRSRSSSKSVGSRSKSKSGRSGSSKGDGRSSSGSRRSSSKSKSTSATEADNVTVATADVKTDIGTVLSTLGTSFEALSKVPAEDWEGFYSDLSTGKTTVDTLSGFSTQLGTIQTTAKTAWTSRATKQKEASEKSTKEAEEVLSGGSNAPASPTTETASSAPPPSTDPPKTEEAKPPEPPPAEAATTEAPSEPPKVEEKPPEKPTEGEKKEEGEAAKPAGEEKKEEKPAEKKEEATKPAEGDKPKEEDKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.06
4 0.07
5 0.09
6 0.11
7 0.11
8 0.14
9 0.16
10 0.16
11 0.22
12 0.26
13 0.32
14 0.38
15 0.46
16 0.54
17 0.62
18 0.71
19 0.74
20 0.78
21 0.81
22 0.82
23 0.82
24 0.8
25 0.78
26 0.74
27 0.74
28 0.73
29 0.72
30 0.69
31 0.69
32 0.67
33 0.68
34 0.67
35 0.64
36 0.65
37 0.62
38 0.65
39 0.63
40 0.62
41 0.57
42 0.6
43 0.6
44 0.52
45 0.51
46 0.43
47 0.39
48 0.39
49 0.38
50 0.37
51 0.39
52 0.41
53 0.37
54 0.42
55 0.45
56 0.48
57 0.51
58 0.53
59 0.51
60 0.51
61 0.54
62 0.53
63 0.51
64 0.45
65 0.41
66 0.34
67 0.3
68 0.26
69 0.22
70 0.17
71 0.13
72 0.1
73 0.07
74 0.06
75 0.05
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.05
82 0.05
83 0.05
84 0.05
85 0.05
86 0.05
87 0.04
88 0.04
89 0.05
90 0.05
91 0.05
92 0.05
93 0.05
94 0.06
95 0.06
96 0.07
97 0.07
98 0.07
99 0.07
100 0.07
101 0.09
102 0.1
103 0.12
104 0.12
105 0.13
106 0.13
107 0.13
108 0.13
109 0.1
110 0.1
111 0.08
112 0.08
113 0.07
114 0.07
115 0.07
116 0.07
117 0.07
118 0.07
119 0.07
120 0.07
121 0.08
122 0.08
123 0.08
124 0.08
125 0.08
126 0.07
127 0.08
128 0.07
129 0.06
130 0.07
131 0.08
132 0.08
133 0.08
134 0.08
135 0.08
136 0.08
137 0.08
138 0.13
139 0.17
140 0.2
141 0.24
142 0.34
143 0.37
144 0.4
145 0.44
146 0.46
147 0.49
148 0.51
149 0.53
150 0.52
151 0.5
152 0.48
153 0.48
154 0.41
155 0.34
156 0.3
157 0.23
158 0.15
159 0.14
160 0.12
161 0.08
162 0.08
163 0.07
164 0.06
165 0.05
166 0.04
167 0.05
168 0.05
169 0.06
170 0.08
171 0.09
172 0.1
173 0.1
174 0.12
175 0.12
176 0.14
177 0.14
178 0.15
179 0.14
180 0.13
181 0.16
182 0.19
183 0.25
184 0.25
185 0.25
186 0.28
187 0.34
188 0.37
189 0.38
190 0.43
191 0.43
192 0.48
193 0.5
194 0.48
195 0.5
196 0.48
197 0.45
198 0.4
199 0.35
200 0.29
201 0.25
202 0.26
203 0.2
204 0.2
205 0.19
206 0.16
207 0.13
208 0.14
209 0.16
210 0.14
211 0.14
212 0.18
213 0.21
214 0.27
215 0.36
216 0.4
217 0.48
218 0.53
219 0.56
220 0.54
221 0.52
222 0.55
223 0.56
224 0.54
225 0.49
226 0.46
227 0.43
228 0.43
229 0.44
230 0.37
231 0.29
232 0.28
233 0.24
234 0.23
235 0.2
236 0.22
237 0.23
238 0.23
239 0.25
240 0.27
241 0.36
242 0.43
243 0.45
244 0.5
245 0.54
246 0.62
247 0.67
248 0.66
249 0.62
250 0.63
251 0.7
252 0.67
253 0.62
254 0.55
255 0.49
256 0.52
257 0.53
258 0.49
259 0.45
260 0.46
261 0.48