Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7Z9J4

Protein Details
Accession C7Z9J4   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-49MVSAKKHVPIVKKRTKRFERHQSDRFKCVDPSWRKPKGIDSRVRRRFRGBasic
NLS Segment(s)
PositionSequence
11-17VKKRTKR
35-45KPKGIDSRVRR
Subcellular Location(s) mito 17.5, mito_nucl 12.833, nucl 7, cyto_nucl 5.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG nhe:NECHADRAFT_70322  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSAKKHVPIVKKRTKRFERHQSDRFKCVDPSWRKPKGIDSRVRRRFRGTIAMPSIGYGSNKKTRYLTPSGHKAFLVSNVQDVELLLMHNRTHAAEIAHNVSSRKRITIIARAKQLGVKVTNPKAKVTTEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.87
3 0.88
4 0.88
5 0.89
6 0.89
7 0.89
8 0.88
9 0.88
10 0.83
11 0.8
12 0.72
13 0.64
14 0.56
15 0.5
16 0.51
17 0.49
18 0.54
19 0.57
20 0.61
21 0.59
22 0.58
23 0.64
24 0.65
25 0.65
26 0.65
27 0.65
28 0.69
29 0.77
30 0.81
31 0.73
32 0.68
33 0.62
34 0.57
35 0.56
36 0.48
37 0.46
38 0.43
39 0.42
40 0.36
41 0.32
42 0.29
43 0.2
44 0.18
45 0.12
46 0.13
47 0.19
48 0.2
49 0.21
50 0.23
51 0.24
52 0.29
53 0.33
54 0.34
55 0.34
56 0.42
57 0.43
58 0.42
59 0.39
60 0.34
61 0.29
62 0.27
63 0.25
64 0.15
65 0.15
66 0.14
67 0.14
68 0.13
69 0.12
70 0.09
71 0.06
72 0.06
73 0.05
74 0.06
75 0.06
76 0.06
77 0.07
78 0.07
79 0.08
80 0.09
81 0.1
82 0.11
83 0.14
84 0.16
85 0.17
86 0.18
87 0.18
88 0.19
89 0.23
90 0.22
91 0.21
92 0.2
93 0.24
94 0.28
95 0.37
96 0.45
97 0.46
98 0.52
99 0.51
100 0.51
101 0.48
102 0.45
103 0.41
104 0.35
105 0.34
106 0.37
107 0.44
108 0.5
109 0.49
110 0.5
111 0.47