Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B9GTU3

Protein Details
Accession A0A1B9GTU3    Localization Confidence High Confidence Score 17.4
NoLS Segment(s)
PositionSequenceProtein Nature
28-54RDAGSSRTRSRSPRRDRDRYDDRDRRYBasic
264-285GAVKVNKQRTWRQYMNRRGGFNHydrophilic
NLS Segment(s)
PositionSequence
33-47SRTRSRSPRRDRDRY
50-61RDRRYDRDRPRG
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013957  SNRNP27  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF08648  SNRNP27  
Amino Acid Sequences MSSRAAPPHLSPRDRDRDRSYARDGRDRDAGSSRTRSRSPRRDRDRYDDRDRRYDRDRPRGSDREPERDRYRGGSRERDGDGYRDDRYSRRAYDDDRTGGRSGVKNEPSRDGGSRDPPRAPYTRDNPNSDPSFRTASSNRYDGPPPAQLRGGPGAYGGGYNRGGPYGGQGGYGGAGIRGDDYERPLDRRAIEEGRRRREEERAKGIVYTEDGSINPSQEASPAPKEEPKEEVDENDPEAAMASMMGFGGFGTTKGKAVEANADGAVKVNKQRTWRQYMNRRGGFNRPLDKVKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.68
3 0.65
4 0.66
5 0.7
6 0.71
7 0.71
8 0.67
9 0.67
10 0.68
11 0.64
12 0.58
13 0.59
14 0.53
15 0.48
16 0.47
17 0.45
18 0.42
19 0.48
20 0.49
21 0.47
22 0.52
23 0.57
24 0.62
25 0.69
26 0.74
27 0.76
28 0.81
29 0.85
30 0.87
31 0.88
32 0.87
33 0.85
34 0.86
35 0.83
36 0.79
37 0.79
38 0.75
39 0.72
40 0.68
41 0.69
42 0.68
43 0.7
44 0.71
45 0.66
46 0.72
47 0.74
48 0.7
49 0.71
50 0.67
51 0.66
52 0.63
53 0.65
54 0.6
55 0.56
56 0.54
57 0.5
58 0.51
59 0.48
60 0.51
61 0.52
62 0.49
63 0.51
64 0.51
65 0.49
66 0.44
67 0.39
68 0.37
69 0.3
70 0.29
71 0.26
72 0.26
73 0.24
74 0.28
75 0.3
76 0.27
77 0.3
78 0.31
79 0.33
80 0.38
81 0.41
82 0.4
83 0.37
84 0.38
85 0.33
86 0.31
87 0.3
88 0.27
89 0.25
90 0.29
91 0.34
92 0.35
93 0.36
94 0.39
95 0.38
96 0.38
97 0.35
98 0.31
99 0.28
100 0.33
101 0.36
102 0.36
103 0.35
104 0.35
105 0.37
106 0.37
107 0.39
108 0.37
109 0.37
110 0.44
111 0.47
112 0.51
113 0.49
114 0.52
115 0.5
116 0.44
117 0.4
118 0.32
119 0.31
120 0.25
121 0.27
122 0.22
123 0.24
124 0.25
125 0.26
126 0.24
127 0.23
128 0.23
129 0.21
130 0.22
131 0.23
132 0.21
133 0.21
134 0.21
135 0.18
136 0.19
137 0.2
138 0.17
139 0.11
140 0.1
141 0.09
142 0.08
143 0.08
144 0.06
145 0.06
146 0.06
147 0.07
148 0.07
149 0.07
150 0.07
151 0.06
152 0.08
153 0.09
154 0.08
155 0.08
156 0.08
157 0.08
158 0.08
159 0.08
160 0.07
161 0.04
162 0.03
163 0.03
164 0.03
165 0.04
166 0.04
167 0.05
168 0.07
169 0.11
170 0.12
171 0.15
172 0.16
173 0.19
174 0.19
175 0.21
176 0.24
177 0.27
178 0.32
179 0.4
180 0.47
181 0.53
182 0.56
183 0.57
184 0.54
185 0.58
186 0.6
187 0.6
188 0.6
189 0.54
190 0.51
191 0.48
192 0.47
193 0.38
194 0.3
195 0.22
196 0.14
197 0.12
198 0.11
199 0.13
200 0.13
201 0.13
202 0.11
203 0.1
204 0.09
205 0.1
206 0.12
207 0.14
208 0.17
209 0.18
210 0.21
211 0.24
212 0.26
213 0.28
214 0.29
215 0.27
216 0.29
217 0.28
218 0.28
219 0.28
220 0.28
221 0.27
222 0.24
223 0.21
224 0.15
225 0.15
226 0.12
227 0.08
228 0.06
229 0.04
230 0.04
231 0.04
232 0.04
233 0.03
234 0.03
235 0.04
236 0.04
237 0.05
238 0.07
239 0.08
240 0.1
241 0.1
242 0.11
243 0.11
244 0.13
245 0.19
246 0.18
247 0.2
248 0.19
249 0.19
250 0.18
251 0.19
252 0.19
253 0.16
254 0.21
255 0.25
256 0.28
257 0.35
258 0.45
259 0.51
260 0.59
261 0.66
262 0.7
263 0.75
264 0.82
265 0.86
266 0.82
267 0.8
268 0.74
269 0.74
270 0.71
271 0.7
272 0.67
273 0.62