Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9GN07

Protein Details
Accession A0A1B9GN07    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
415-435ATDDLEPIRRRRRRGAEDQESHydrophilic
NLS Segment(s)
PositionSequence
424-427RRRR
Subcellular Location(s) plas 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR030185  Mae1  
IPR004695  SLAC1/Mae1/Ssu1/TehA  
IPR038665  Voltage-dep_anion_channel_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0015140  F:malate transmembrane transporter activity  
Pfam View protein in Pfam  
PF03595  SLAC1  
Amino Acid Sequences MAEKELLDSRAPFRQTTFKQRLRETEWSKRWGWNLYTTAMGSGAVMACIYSVPYEFHGQKPAATVWFIVDICLFILCTVMTTIRAIKHTAVFRHSFYDQTEAPWMPTFNLSIATLIIGIIDLGIPKCGPWLITTAEVLFYIYMFIGACTALILQNTYRLLPRPLHLISPAECLEAFPLMLCGTIGSLLAPQVNKLRPDGALTILLFAIICQGLGLFISILKLSAWMLHHIVLPRAPSKTLPAYMIAAGVPGFTALALVNGGNAALEIFPTNGFLSAQAQGGIGIDPRIAAEVFAIVGHWFGLLMCGLFLWVVLIYVGWGFFNMVSMARNGYLGQYNLAWWAWTFPLTGMISCWGQWAKYFPSKAFGVLNIIGTLFVLCIWIFNIIGTGVLLYNGILPGVPEEFVPTHNDEDGELATDDLEPIRRRRRRGAEDQES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.43
3 0.52
4 0.59
5 0.59
6 0.65
7 0.71
8 0.75
9 0.73
10 0.77
11 0.75
12 0.75
13 0.75
14 0.73
15 0.7
16 0.66
17 0.63
18 0.59
19 0.54
20 0.51
21 0.47
22 0.42
23 0.41
24 0.36
25 0.32
26 0.25
27 0.21
28 0.13
29 0.11
30 0.09
31 0.07
32 0.06
33 0.05
34 0.05
35 0.05
36 0.06
37 0.05
38 0.06
39 0.07
40 0.1
41 0.16
42 0.19
43 0.21
44 0.27
45 0.27
46 0.27
47 0.29
48 0.29
49 0.25
50 0.23
51 0.21
52 0.16
53 0.2
54 0.18
55 0.15
56 0.13
57 0.11
58 0.11
59 0.11
60 0.09
61 0.05
62 0.06
63 0.05
64 0.05
65 0.06
66 0.06
67 0.07
68 0.09
69 0.12
70 0.14
71 0.16
72 0.17
73 0.19
74 0.24
75 0.28
76 0.31
77 0.33
78 0.33
79 0.33
80 0.36
81 0.35
82 0.31
83 0.27
84 0.29
85 0.24
86 0.23
87 0.27
88 0.22
89 0.23
90 0.22
91 0.21
92 0.17
93 0.18
94 0.16
95 0.12
96 0.13
97 0.12
98 0.1
99 0.1
100 0.09
101 0.08
102 0.07
103 0.06
104 0.04
105 0.03
106 0.03
107 0.03
108 0.04
109 0.04
110 0.05
111 0.05
112 0.05
113 0.06
114 0.06
115 0.06
116 0.06
117 0.09
118 0.1
119 0.12
120 0.13
121 0.12
122 0.12
123 0.12
124 0.11
125 0.08
126 0.06
127 0.05
128 0.05
129 0.05
130 0.04
131 0.04
132 0.04
133 0.04
134 0.04
135 0.04
136 0.04
137 0.05
138 0.05
139 0.06
140 0.05
141 0.09
142 0.1
143 0.1
144 0.11
145 0.12
146 0.15
147 0.16
148 0.17
149 0.2
150 0.2
151 0.21
152 0.21
153 0.22
154 0.2
155 0.22
156 0.22
157 0.16
158 0.15
159 0.14
160 0.13
161 0.11
162 0.09
163 0.05
164 0.05
165 0.04
166 0.04
167 0.04
168 0.03
169 0.03
170 0.04
171 0.04
172 0.03
173 0.03
174 0.04
175 0.05
176 0.05
177 0.07
178 0.11
179 0.14
180 0.14
181 0.15
182 0.16
183 0.15
184 0.17
185 0.17
186 0.13
187 0.13
188 0.12
189 0.12
190 0.11
191 0.1
192 0.08
193 0.06
194 0.06
195 0.04
196 0.03
197 0.03
198 0.03
199 0.03
200 0.03
201 0.03
202 0.02
203 0.02
204 0.03
205 0.03
206 0.03
207 0.03
208 0.04
209 0.04
210 0.06
211 0.06
212 0.08
213 0.09
214 0.09
215 0.11
216 0.11
217 0.12
218 0.11
219 0.12
220 0.13
221 0.13
222 0.13
223 0.11
224 0.14
225 0.16
226 0.17
227 0.16
228 0.15
229 0.15
230 0.15
231 0.15
232 0.11
233 0.09
234 0.07
235 0.06
236 0.05
237 0.03
238 0.03
239 0.02
240 0.03
241 0.03
242 0.03
243 0.03
244 0.03
245 0.03
246 0.03
247 0.03
248 0.03
249 0.03
250 0.03
251 0.02
252 0.03
253 0.03
254 0.04
255 0.04
256 0.05
257 0.05
258 0.05
259 0.06
260 0.06
261 0.08
262 0.09
263 0.09
264 0.08
265 0.08
266 0.08
267 0.08
268 0.08
269 0.06
270 0.05
271 0.05
272 0.04
273 0.04
274 0.05
275 0.05
276 0.05
277 0.04
278 0.04
279 0.04
280 0.04
281 0.05
282 0.04
283 0.04
284 0.04
285 0.03
286 0.03
287 0.03
288 0.04
289 0.04
290 0.04
291 0.03
292 0.03
293 0.03
294 0.03
295 0.03
296 0.03
297 0.03
298 0.03
299 0.03
300 0.03
301 0.03
302 0.03
303 0.04
304 0.03
305 0.03
306 0.04
307 0.04
308 0.05
309 0.05
310 0.06
311 0.06
312 0.07
313 0.08
314 0.08
315 0.09
316 0.08
317 0.1
318 0.12
319 0.12
320 0.12
321 0.11
322 0.11
323 0.13
324 0.12
325 0.11
326 0.08
327 0.09
328 0.09
329 0.09
330 0.1
331 0.08
332 0.14
333 0.14
334 0.14
335 0.13
336 0.15
337 0.15
338 0.14
339 0.18
340 0.13
341 0.12
342 0.13
343 0.17
344 0.21
345 0.28
346 0.31
347 0.28
348 0.33
349 0.33
350 0.34
351 0.32
352 0.26
353 0.24
354 0.22
355 0.23
356 0.18
357 0.17
358 0.14
359 0.13
360 0.12
361 0.06
362 0.05
363 0.05
364 0.04
365 0.05
366 0.06
367 0.07
368 0.07
369 0.06
370 0.07
371 0.06
372 0.07
373 0.06
374 0.06
375 0.05
376 0.05
377 0.05
378 0.05
379 0.06
380 0.06
381 0.06
382 0.05
383 0.05
384 0.07
385 0.08
386 0.08
387 0.07
388 0.11
389 0.12
390 0.13
391 0.17
392 0.18
393 0.2
394 0.21
395 0.21
396 0.18
397 0.19
398 0.18
399 0.17
400 0.14
401 0.11
402 0.11
403 0.11
404 0.11
405 0.1
406 0.16
407 0.18
408 0.26
409 0.37
410 0.43
411 0.5
412 0.6
413 0.7
414 0.74
415 0.81