Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9GR73

Protein Details
Accession A0A1B9GR73    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
603-633VKMQEKMYENMQRKKRRARDERERRLERESQBasic
NLS Segment(s)
PositionSequence
615-627RKKRRARDERERR
Subcellular Location(s) mito 18, nucl 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR043837  Mtf2-like_C  
IPR040009  Mtf2/C5D6.12-like  
Gene Ontology GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF19189  Mtf2  
Amino Acid Sequences MIHSIESGVVLPLLKRSRPRPSTASAARQFIASKCQPREIKTYNAGREFSSTASINADADGNANRSGTSKADLSSIDTTKPDIARSDSSAQSQSQSQSQSSKEASTPPTKPLKATDPGFKDHQSSWVNSIVSTARADLRNDHATRLSPPGSYTGAGTGNAIAGVGVSRDMSGSAESSRGAAMGWAKPATPSTSTSSTPPQPSPPQSISSRLTYSPFATPSPRRGVHARQRRAAGQTPKEAETFDAILAGIFANLESSTSTSSSFSNRSRTRTSPGGAGGGVVSDPYAAARGGGRAGVGAGFGLGRSTGVGDRARNLRRWFERDEVDDEVVEELEMLKEEMAVIGDDVELIEWAKNRVFKPLAPIDVSATRQTALNPADDQSKSNGDSATSNTAASPVPAPFLTFAPTYPKILAHLLRTLRVNYNSPHLVLSLFHYAQTSSLESYLSGCLTGAYNEVLTAKWESFRDFVGVENGIREMEVMGVNWDAATARLVSRIVEEVSRDLLPFVNESESGSAGVNRLGMAGLDFSDPNGAEDSTSGFKNLSTMMGGGSGAGGSAYSKSNLNWKYGGLLSITAGSFGSGVGGANDMLERLGRLEKKVQKDVKMQEKMYENMQRKKRRARDERERRLERESQEGAYDGAVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.31
3 0.39
4 0.49
5 0.54
6 0.61
7 0.6
8 0.61
9 0.67
10 0.68
11 0.71
12 0.66
13 0.64
14 0.57
15 0.52
16 0.49
17 0.4
18 0.41
19 0.38
20 0.41
21 0.41
22 0.5
23 0.53
24 0.55
25 0.63
26 0.59
27 0.6
28 0.6
29 0.66
30 0.65
31 0.65
32 0.62
33 0.53
34 0.52
35 0.45
36 0.37
37 0.33
38 0.25
39 0.2
40 0.21
41 0.21
42 0.17
43 0.16
44 0.15
45 0.11
46 0.12
47 0.14
48 0.13
49 0.14
50 0.13
51 0.13
52 0.14
53 0.16
54 0.16
55 0.16
56 0.16
57 0.16
58 0.18
59 0.18
60 0.22
61 0.26
62 0.25
63 0.24
64 0.23
65 0.24
66 0.26
67 0.27
68 0.24
69 0.21
70 0.24
71 0.25
72 0.3
73 0.33
74 0.31
75 0.33
76 0.34
77 0.32
78 0.3
79 0.3
80 0.27
81 0.26
82 0.27
83 0.26
84 0.28
85 0.29
86 0.32
87 0.3
88 0.31
89 0.28
90 0.31
91 0.34
92 0.37
93 0.38
94 0.4
95 0.47
96 0.46
97 0.46
98 0.45
99 0.47
100 0.46
101 0.48
102 0.5
103 0.45
104 0.48
105 0.5
106 0.47
107 0.43
108 0.36
109 0.41
110 0.35
111 0.33
112 0.32
113 0.33
114 0.32
115 0.28
116 0.29
117 0.22
118 0.2
119 0.18
120 0.17
121 0.16
122 0.18
123 0.19
124 0.2
125 0.25
126 0.32
127 0.32
128 0.33
129 0.31
130 0.3
131 0.31
132 0.34
133 0.29
134 0.21
135 0.21
136 0.22
137 0.22
138 0.2
139 0.18
140 0.15
141 0.15
142 0.15
143 0.14
144 0.11
145 0.09
146 0.09
147 0.08
148 0.05
149 0.04
150 0.04
151 0.03
152 0.03
153 0.03
154 0.04
155 0.04
156 0.04
157 0.05
158 0.06
159 0.07
160 0.07
161 0.08
162 0.08
163 0.08
164 0.08
165 0.07
166 0.06
167 0.07
168 0.09
169 0.1
170 0.13
171 0.13
172 0.13
173 0.13
174 0.15
175 0.16
176 0.15
177 0.16
178 0.19
179 0.22
180 0.23
181 0.26
182 0.3
183 0.33
184 0.35
185 0.33
186 0.34
187 0.37
188 0.4
189 0.44
190 0.41
191 0.41
192 0.39
193 0.43
194 0.4
195 0.37
196 0.35
197 0.3
198 0.29
199 0.26
200 0.26
201 0.23
202 0.22
203 0.2
204 0.24
205 0.26
206 0.29
207 0.35
208 0.34
209 0.34
210 0.38
211 0.46
212 0.5
213 0.58
214 0.59
215 0.56
216 0.58
217 0.58
218 0.58
219 0.56
220 0.55
221 0.49
222 0.49
223 0.47
224 0.45
225 0.42
226 0.37
227 0.3
228 0.23
229 0.19
230 0.12
231 0.1
232 0.08
233 0.07
234 0.07
235 0.06
236 0.04
237 0.03
238 0.03
239 0.03
240 0.03
241 0.03
242 0.03
243 0.04
244 0.05
245 0.06
246 0.07
247 0.08
248 0.09
249 0.11
250 0.16
251 0.17
252 0.26
253 0.29
254 0.33
255 0.38
256 0.39
257 0.42
258 0.42
259 0.41
260 0.35
261 0.32
262 0.28
263 0.23
264 0.2
265 0.15
266 0.1
267 0.08
268 0.05
269 0.04
270 0.03
271 0.03
272 0.02
273 0.03
274 0.03
275 0.03
276 0.04
277 0.04
278 0.05
279 0.05
280 0.05
281 0.04
282 0.04
283 0.04
284 0.03
285 0.03
286 0.03
287 0.02
288 0.02
289 0.02
290 0.02
291 0.02
292 0.02
293 0.03
294 0.04
295 0.07
296 0.09
297 0.09
298 0.12
299 0.19
300 0.22
301 0.26
302 0.28
303 0.32
304 0.35
305 0.4
306 0.41
307 0.38
308 0.38
309 0.36
310 0.37
311 0.32
312 0.28
313 0.23
314 0.19
315 0.15
316 0.12
317 0.09
318 0.06
319 0.04
320 0.03
321 0.03
322 0.03
323 0.03
324 0.03
325 0.03
326 0.03
327 0.03
328 0.03
329 0.03
330 0.03
331 0.03
332 0.03
333 0.03
334 0.03
335 0.03
336 0.03
337 0.04
338 0.04
339 0.05
340 0.07
341 0.11
342 0.12
343 0.17
344 0.18
345 0.18
346 0.25
347 0.28
348 0.29
349 0.26
350 0.26
351 0.23
352 0.24
353 0.25
354 0.19
355 0.16
356 0.14
357 0.13
358 0.13
359 0.15
360 0.14
361 0.14
362 0.13
363 0.14
364 0.18
365 0.18
366 0.19
367 0.16
368 0.17
369 0.17
370 0.18
371 0.17
372 0.13
373 0.14
374 0.15
375 0.17
376 0.15
377 0.14
378 0.13
379 0.14
380 0.13
381 0.12
382 0.11
383 0.07
384 0.08
385 0.08
386 0.09
387 0.09
388 0.09
389 0.11
390 0.1
391 0.1
392 0.16
393 0.17
394 0.18
395 0.18
396 0.17
397 0.17
398 0.21
399 0.22
400 0.18
401 0.22
402 0.22
403 0.24
404 0.25
405 0.26
406 0.26
407 0.27
408 0.27
409 0.23
410 0.28
411 0.26
412 0.25
413 0.23
414 0.19
415 0.17
416 0.14
417 0.16
418 0.16
419 0.15
420 0.15
421 0.14
422 0.14
423 0.14
424 0.16
425 0.14
426 0.09
427 0.09
428 0.09
429 0.09
430 0.1
431 0.1
432 0.09
433 0.07
434 0.06
435 0.07
436 0.07
437 0.07
438 0.07
439 0.06
440 0.06
441 0.06
442 0.07
443 0.07
444 0.08
445 0.09
446 0.09
447 0.11
448 0.12
449 0.14
450 0.14
451 0.15
452 0.15
453 0.14
454 0.14
455 0.14
456 0.15
457 0.13
458 0.13
459 0.12
460 0.1
461 0.1
462 0.09
463 0.06
464 0.06
465 0.06
466 0.06
467 0.06
468 0.07
469 0.07
470 0.06
471 0.06
472 0.05
473 0.05
474 0.06
475 0.06
476 0.06
477 0.08
478 0.08
479 0.09
480 0.1
481 0.11
482 0.12
483 0.12
484 0.13
485 0.12
486 0.15
487 0.15
488 0.14
489 0.12
490 0.13
491 0.12
492 0.12
493 0.12
494 0.11
495 0.11
496 0.12
497 0.12
498 0.12
499 0.12
500 0.11
501 0.11
502 0.09
503 0.1
504 0.09
505 0.08
506 0.08
507 0.07
508 0.06
509 0.06
510 0.06
511 0.06
512 0.07
513 0.07
514 0.07
515 0.09
516 0.09
517 0.1
518 0.11
519 0.1
520 0.09
521 0.09
522 0.12
523 0.13
524 0.13
525 0.13
526 0.11
527 0.11
528 0.12
529 0.13
530 0.1
531 0.09
532 0.09
533 0.09
534 0.09
535 0.09
536 0.08
537 0.07
538 0.05
539 0.04
540 0.04
541 0.03
542 0.03
543 0.05
544 0.07
545 0.08
546 0.09
547 0.11
548 0.2
549 0.22
550 0.25
551 0.25
552 0.24
553 0.27
554 0.27
555 0.27
556 0.19
557 0.18
558 0.15
559 0.16
560 0.16
561 0.12
562 0.11
563 0.1
564 0.08
565 0.08
566 0.07
567 0.05
568 0.05
569 0.05
570 0.06
571 0.05
572 0.06
573 0.06
574 0.06
575 0.06
576 0.06
577 0.06
578 0.07
579 0.15
580 0.17
581 0.21
582 0.31
583 0.38
584 0.46
585 0.56
586 0.61
587 0.61
588 0.68
589 0.74
590 0.75
591 0.76
592 0.69
593 0.66
594 0.64
595 0.59
596 0.58
597 0.58
598 0.56
599 0.57
600 0.65
601 0.69
602 0.73
603 0.82
604 0.83
605 0.85
606 0.87
607 0.89
608 0.91
609 0.92
610 0.94
611 0.94
612 0.92
613 0.84
614 0.81
615 0.78
616 0.7
617 0.67
618 0.59
619 0.5
620 0.44
621 0.41
622 0.34