Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B9H2W4

Protein Details
Accession A0A1B9H2W4    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
335-357LVPGTPDYKRRRVGKRKTADLATHydrophilic
NLS Segment(s)
PositionSequence
344-350RRRVGKR
Subcellular Location(s) nucl 17, cyto_nucl 12, cyto 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003120  Ste12  
Gene Ontology GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF02200  STE  
Amino Acid Sequences MPALGTSHGTPTELRTLPSNGPSSHKYRASSTDPGDESVTADVLRIDSQDDQSLTKASTDLHEDFYPLPMPCGLPPRRLNEEESIRVKTLGRLQFFLTTAPTFWIENPLSTTFLNSFTLPNGENVSCVLWQGLYHISGTDIVRALAFRFEAFGRPVRAVKKWEEGVFSDLRNLKPGPDATLEEPKSKLLEYLFRNGCIRTQKKVCLSLVHLFSVPHDRLFLDALERDLKREKAGLTPTTVVSGEPALSFRYDPTRSLYDQFAGQNPGLGSSAADTTAQVTTIPLDICAPASHTRIGASRSESDRPRSMSRPATSLAPADSTSERLHDPRVFRGSLVPGTPDYKRRRVGKRKTADLATQIAHPCSLNRDRHVPPDPYDARAHRPWTSSPQLYPKGLNEHAGPIVVRTRIVTDPSSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.3
4 0.33
5 0.39
6 0.4
7 0.33
8 0.38
9 0.42
10 0.44
11 0.48
12 0.49
13 0.45
14 0.45
15 0.5
16 0.51
17 0.54
18 0.51
19 0.52
20 0.48
21 0.47
22 0.44
23 0.37
24 0.31
25 0.24
26 0.21
27 0.12
28 0.11
29 0.1
30 0.09
31 0.09
32 0.09
33 0.1
34 0.12
35 0.14
36 0.17
37 0.18
38 0.18
39 0.19
40 0.2
41 0.18
42 0.16
43 0.15
44 0.12
45 0.13
46 0.19
47 0.19
48 0.22
49 0.21
50 0.23
51 0.22
52 0.24
53 0.25
54 0.19
55 0.18
56 0.15
57 0.16
58 0.17
59 0.26
60 0.27
61 0.32
62 0.37
63 0.43
64 0.49
65 0.5
66 0.52
67 0.51
68 0.54
69 0.53
70 0.52
71 0.49
72 0.42
73 0.41
74 0.38
75 0.33
76 0.35
77 0.34
78 0.32
79 0.3
80 0.31
81 0.33
82 0.33
83 0.3
84 0.24
85 0.18
86 0.16
87 0.16
88 0.16
89 0.13
90 0.13
91 0.19
92 0.17
93 0.17
94 0.2
95 0.19
96 0.2
97 0.19
98 0.21
99 0.15
100 0.16
101 0.17
102 0.14
103 0.14
104 0.13
105 0.15
106 0.14
107 0.14
108 0.15
109 0.14
110 0.13
111 0.13
112 0.14
113 0.11
114 0.11
115 0.1
116 0.06
117 0.06
118 0.08
119 0.09
120 0.08
121 0.08
122 0.08
123 0.08
124 0.11
125 0.11
126 0.11
127 0.09
128 0.09
129 0.09
130 0.09
131 0.09
132 0.08
133 0.08
134 0.06
135 0.07
136 0.08
137 0.1
138 0.12
139 0.15
140 0.16
141 0.17
142 0.21
143 0.22
144 0.25
145 0.27
146 0.29
147 0.31
148 0.33
149 0.33
150 0.31
151 0.3
152 0.31
153 0.28
154 0.25
155 0.23
156 0.23
157 0.22
158 0.22
159 0.21
160 0.18
161 0.19
162 0.2
163 0.18
164 0.17
165 0.19
166 0.19
167 0.27
168 0.28
169 0.26
170 0.26
171 0.24
172 0.22
173 0.2
174 0.18
175 0.11
176 0.17
177 0.18
178 0.26
179 0.26
180 0.27
181 0.28
182 0.26
183 0.29
184 0.31
185 0.31
186 0.28
187 0.32
188 0.36
189 0.39
190 0.43
191 0.4
192 0.34
193 0.36
194 0.35
195 0.32
196 0.28
197 0.24
198 0.2
199 0.2
200 0.23
201 0.19
202 0.13
203 0.12
204 0.11
205 0.12
206 0.13
207 0.12
208 0.08
209 0.08
210 0.09
211 0.13
212 0.13
213 0.14
214 0.17
215 0.17
216 0.16
217 0.18
218 0.18
219 0.18
220 0.23
221 0.22
222 0.22
223 0.23
224 0.22
225 0.21
226 0.2
227 0.15
228 0.11
229 0.1
230 0.08
231 0.06
232 0.07
233 0.06
234 0.07
235 0.07
236 0.08
237 0.13
238 0.14
239 0.15
240 0.19
241 0.22
242 0.23
243 0.25
244 0.26
245 0.21
246 0.22
247 0.23
248 0.2
249 0.19
250 0.17
251 0.17
252 0.16
253 0.16
254 0.13
255 0.12
256 0.09
257 0.08
258 0.08
259 0.06
260 0.07
261 0.06
262 0.07
263 0.07
264 0.07
265 0.06
266 0.06
267 0.06
268 0.08
269 0.08
270 0.06
271 0.07
272 0.07
273 0.08
274 0.08
275 0.1
276 0.12
277 0.14
278 0.14
279 0.14
280 0.15
281 0.17
282 0.19
283 0.19
284 0.2
285 0.23
286 0.27
287 0.33
288 0.35
289 0.38
290 0.41
291 0.43
292 0.45
293 0.43
294 0.46
295 0.48
296 0.46
297 0.44
298 0.4
299 0.38
300 0.34
301 0.32
302 0.26
303 0.19
304 0.18
305 0.17
306 0.17
307 0.17
308 0.16
309 0.17
310 0.18
311 0.18
312 0.23
313 0.25
314 0.27
315 0.31
316 0.36
317 0.34
318 0.33
319 0.35
320 0.34
321 0.32
322 0.3
323 0.25
324 0.22
325 0.25
326 0.28
327 0.33
328 0.36
329 0.41
330 0.48
331 0.55
332 0.64
333 0.72
334 0.8
335 0.82
336 0.84
337 0.85
338 0.84
339 0.8
340 0.73
341 0.67
342 0.6
343 0.5
344 0.46
345 0.39
346 0.32
347 0.28
348 0.24
349 0.21
350 0.24
351 0.31
352 0.32
353 0.35
354 0.42
355 0.44
356 0.52
357 0.59
358 0.56
359 0.52
360 0.56
361 0.54
362 0.5
363 0.54
364 0.49
365 0.49
366 0.51
367 0.52
368 0.45
369 0.47
370 0.48
371 0.49
372 0.54
373 0.52
374 0.51
375 0.56
376 0.58
377 0.58
378 0.56
379 0.52
380 0.52
381 0.49
382 0.46
383 0.38
384 0.36
385 0.33
386 0.31
387 0.26
388 0.21
389 0.24
390 0.21
391 0.2
392 0.17
393 0.2
394 0.22
395 0.25