Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9H1J7

Protein Details
Accession A0A1B9H1J7   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
16-41QAGSRAGKKKKWSKGKVKDKANNAVVHydrophilic
NLS Segment(s)
PositionSequence
11-35KAAAAQAGSRAGKKKKWSKGKVKDK
Subcellular Location(s) nucl 11, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPPQVKSKAQKAAAAQAGSRAGKKKKWSKGKVKDKANNAVVVDKAVYDRILKEVPTYKLISQSVLIDRMKINGSLARRAIAFLEKEGLIKRVVHHHAQLIYTRATAAKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.4
3 0.34
4 0.35
5 0.32
6 0.32
7 0.31
8 0.31
9 0.35
10 0.45
11 0.51
12 0.57
13 0.67
14 0.74
15 0.78
16 0.84
17 0.9
18 0.89
19 0.9
20 0.87
21 0.83
22 0.82
23 0.73
24 0.65
25 0.54
26 0.47
27 0.36
28 0.29
29 0.22
30 0.13
31 0.11
32 0.08
33 0.08
34 0.06
35 0.07
36 0.09
37 0.09
38 0.09
39 0.11
40 0.16
41 0.17
42 0.19
43 0.2
44 0.18
45 0.22
46 0.22
47 0.21
48 0.17
49 0.17
50 0.16
51 0.19
52 0.18
53 0.15
54 0.15
55 0.16
56 0.16
57 0.14
58 0.14
59 0.13
60 0.15
61 0.18
62 0.18
63 0.18
64 0.17
65 0.17
66 0.17
67 0.18
68 0.17
69 0.13
70 0.15
71 0.14
72 0.16
73 0.17
74 0.17
75 0.15
76 0.15
77 0.16
78 0.23
79 0.27
80 0.3
81 0.31
82 0.35
83 0.36
84 0.37
85 0.38
86 0.32
87 0.29
88 0.25
89 0.24