Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B9GP62

Protein Details
Accession A0A1B9GP62    Localization Confidence High Confidence Score 20.3
NoLS Segment(s)
PositionSequenceProtein Nature
118-137SSSPAKKKSAPKKTKGKAEPHydrophilic
144-169KDGEAEKKSKKPRARKAKKEESEPLTBasic
176-197EPEVLPKKKRSAPKKAAKAESDHydrophilic
224-249EEEEVKPPSKKARKPRSRKKAANDSNBasic
NLS Segment(s)
PositionSequence
121-162PAKKKSAPKKTKGKAEPEAEVNGKDGEAEKKSKKPRARKAKK
181-197PKKKRSAPKKAAKAESD
199-221EEDVKPAKKAAGSKRGKKIKAES
226-244EEVKPPSKKARKPRSRKKA
Subcellular Location(s) nucl 15, mito_nucl 11.999, cyto_nucl 10.833, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001510  Znf_PARP  
IPR036957  Znf_PARP_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00645  zf-PARP  
PROSITE View protein in PROSITE  
PS50064  ZF_PARP_2  
Amino Acid Sequences MPAYRLEVAPTARSQCNGPKPCKGTKIGKGELRLGVWVEVMGNGSFKWKHWGCVSEKVISNIKGDFPDPADLDGYDELPENYQEKVSAAMEEGHVADEDVPDSARKPPTPEGEEGEPSSSPAKKKSAPKKTKGKAEPEAEVNGKDGEAEKKSKKPRARKAKKEESEPLTEESEESEPEVLPKKKRSAPKKAAKAESDDEEDVKPAKKAAGSKRGKKIKAESDDEEEEVKPPSKKARKPRSRKKAANDSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.36
3 0.44
4 0.49
5 0.5
6 0.54
7 0.59
8 0.65
9 0.68
10 0.67
11 0.66
12 0.66
13 0.71
14 0.69
15 0.68
16 0.65
17 0.63
18 0.58
19 0.49
20 0.41
21 0.33
22 0.25
23 0.2
24 0.16
25 0.11
26 0.09
27 0.09
28 0.08
29 0.07
30 0.07
31 0.11
32 0.11
33 0.12
34 0.21
35 0.2
36 0.24
37 0.28
38 0.35
39 0.35
40 0.45
41 0.47
42 0.44
43 0.45
44 0.45
45 0.46
46 0.41
47 0.37
48 0.28
49 0.27
50 0.22
51 0.21
52 0.18
53 0.15
54 0.17
55 0.16
56 0.16
57 0.15
58 0.13
59 0.15
60 0.14
61 0.12
62 0.09
63 0.09
64 0.08
65 0.08
66 0.09
67 0.08
68 0.08
69 0.08
70 0.08
71 0.08
72 0.1
73 0.09
74 0.09
75 0.08
76 0.09
77 0.09
78 0.09
79 0.09
80 0.07
81 0.07
82 0.06
83 0.06
84 0.05
85 0.05
86 0.05
87 0.05
88 0.05
89 0.06
90 0.1
91 0.12
92 0.13
93 0.16
94 0.21
95 0.27
96 0.3
97 0.31
98 0.3
99 0.3
100 0.31
101 0.28
102 0.24
103 0.18
104 0.16
105 0.16
106 0.15
107 0.13
108 0.14
109 0.18
110 0.22
111 0.31
112 0.41
113 0.5
114 0.57
115 0.65
116 0.73
117 0.76
118 0.81
119 0.78
120 0.75
121 0.71
122 0.66
123 0.59
124 0.5
125 0.47
126 0.38
127 0.32
128 0.25
129 0.17
130 0.13
131 0.11
132 0.1
133 0.1
134 0.12
135 0.17
136 0.2
137 0.27
138 0.36
139 0.44
140 0.51
141 0.58
142 0.67
143 0.73
144 0.81
145 0.84
146 0.87
147 0.9
148 0.87
149 0.84
150 0.82
151 0.75
152 0.7
153 0.61
154 0.53
155 0.43
156 0.37
157 0.29
158 0.23
159 0.19
160 0.14
161 0.12
162 0.1
163 0.09
164 0.1
165 0.18
166 0.2
167 0.25
168 0.3
169 0.37
170 0.43
171 0.52
172 0.6
173 0.64
174 0.7
175 0.76
176 0.81
177 0.82
178 0.83
179 0.76
180 0.73
181 0.66
182 0.59
183 0.54
184 0.44
185 0.37
186 0.3
187 0.29
188 0.24
189 0.22
190 0.18
191 0.14
192 0.15
193 0.16
194 0.24
195 0.32
196 0.41
197 0.49
198 0.58
199 0.67
200 0.75
201 0.76
202 0.76
203 0.75
204 0.75
205 0.74
206 0.71
207 0.66
208 0.63
209 0.62
210 0.56
211 0.49
212 0.39
213 0.32
214 0.28
215 0.28
216 0.22
217 0.23
218 0.33
219 0.4
220 0.49
221 0.59
222 0.67
223 0.74
224 0.83
225 0.91
226 0.92
227 0.94
228 0.94
229 0.94