Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B9GYC2

Protein Details
Accession A0A1B9GYC2    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
43-63RSASRGSRKRDRFKNLFKRGGBasic
NLS Segment(s)
PositionSequence
49-55SRKRDRF
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MSGAYQTTLREVYERVGWRQSSSCPCFLSPSEQELLQAQEASRSASRGSRKRDRFKNLFKRGGSSSGSAGTAANTAGLFEAAGTEIHEMDAHGTEISELGGSCIHELSSGHQHTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.31
4 0.31
5 0.32
6 0.33
7 0.37
8 0.39
9 0.4
10 0.41
11 0.37
12 0.36
13 0.37
14 0.36
15 0.37
16 0.3
17 0.29
18 0.27
19 0.25
20 0.25
21 0.22
22 0.23
23 0.16
24 0.14
25 0.1
26 0.1
27 0.11
28 0.12
29 0.12
30 0.11
31 0.11
32 0.15
33 0.23
34 0.28
35 0.36
36 0.44
37 0.52
38 0.61
39 0.69
40 0.74
41 0.75
42 0.79
43 0.82
44 0.81
45 0.8
46 0.7
47 0.65
48 0.58
49 0.52
50 0.43
51 0.33
52 0.25
53 0.19
54 0.18
55 0.15
56 0.13
57 0.09
58 0.08
59 0.06
60 0.06
61 0.05
62 0.04
63 0.04
64 0.04
65 0.04
66 0.03
67 0.03
68 0.04
69 0.04
70 0.04
71 0.05
72 0.05
73 0.05
74 0.06
75 0.05
76 0.06
77 0.07
78 0.07
79 0.06
80 0.06
81 0.06
82 0.06
83 0.07
84 0.06
85 0.05
86 0.05
87 0.06
88 0.07
89 0.07
90 0.07
91 0.07
92 0.08
93 0.08
94 0.13
95 0.21