Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9H3Y9

Protein Details
Accession A0A1B9H3Y9    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
100-126IDGGMRRHPDRKKRIRRSDRKGIVSGPBasic
NLS Segment(s)
PositionSequence
29-33KRRRR
105-120RRHPDRKKRIRRSDRK
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MQRPNRSHDEHSKDLRSSAAREWLGSNSKRRRRDGSRDGRETLNRRDLTVRPPQASAALRMAITKESATSWAPRRDRKQLDETAKVALADILSHPDLMGIDGGMRRHPDRKKRIRRSDRKGIVSGPGLLEGSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.52
3 0.45
4 0.39
5 0.35
6 0.36
7 0.3
8 0.3
9 0.31
10 0.32
11 0.36
12 0.37
13 0.44
14 0.45
15 0.54
16 0.6
17 0.64
18 0.68
19 0.7
20 0.76
21 0.77
22 0.78
23 0.79
24 0.77
25 0.75
26 0.7
27 0.67
28 0.62
29 0.58
30 0.55
31 0.45
32 0.41
33 0.43
34 0.4
35 0.39
36 0.43
37 0.41
38 0.33
39 0.33
40 0.32
41 0.33
42 0.32
43 0.28
44 0.2
45 0.16
46 0.15
47 0.14
48 0.15
49 0.1
50 0.1
51 0.08
52 0.06
53 0.06
54 0.07
55 0.08
56 0.12
57 0.17
58 0.24
59 0.28
60 0.35
61 0.39
62 0.47
63 0.52
64 0.54
65 0.55
66 0.57
67 0.59
68 0.57
69 0.53
70 0.45
71 0.4
72 0.34
73 0.26
74 0.18
75 0.11
76 0.07
77 0.07
78 0.08
79 0.08
80 0.08
81 0.08
82 0.07
83 0.08
84 0.08
85 0.07
86 0.04
87 0.05
88 0.07
89 0.08
90 0.09
91 0.13
92 0.15
93 0.23
94 0.32
95 0.41
96 0.51
97 0.61
98 0.71
99 0.79
100 0.89
101 0.92
102 0.95
103 0.94
104 0.94
105 0.93
106 0.88
107 0.8
108 0.71
109 0.66
110 0.58
111 0.5
112 0.4
113 0.31