Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9GRU1

Protein Details
Accession A0A1B9GRU1    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
14-45FTTIRTRRTYCKGKACRKHTPHKVTQYKKGKDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 9.5, cyto_nucl 7.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MDRNTNEINHLSTFTTIRTRRTYCKGKACRKHTPHKVTQYKKGKDSLAAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTSCKTKHQLSLKRCKHFELGGDKKQRGAAISF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.26
3 0.25
4 0.29
5 0.35
6 0.39
7 0.44
8 0.53
9 0.6
10 0.59
11 0.68
12 0.73
13 0.76
14 0.82
15 0.83
16 0.84
17 0.83
18 0.86
19 0.86
20 0.84
21 0.83
22 0.83
23 0.86
24 0.81
25 0.83
26 0.83
27 0.77
28 0.72
29 0.67
30 0.57
31 0.51
32 0.48
33 0.47
34 0.47
35 0.45
36 0.45
37 0.46
38 0.49
39 0.52
40 0.53
41 0.49
42 0.49
43 0.53
44 0.55
45 0.57
46 0.56
47 0.55
48 0.54
49 0.57
50 0.48
51 0.43
52 0.4
53 0.33
54 0.36
55 0.38
56 0.37
57 0.32
58 0.39
59 0.43
60 0.52
61 0.6
62 0.63
63 0.63
64 0.66
65 0.73
66 0.73
67 0.72
68 0.69
69 0.64
70 0.61
71 0.6
72 0.56
73 0.51
74 0.49
75 0.43
76 0.41
77 0.42
78 0.42
79 0.45
80 0.52
81 0.57
82 0.61
83 0.71
84 0.75
85 0.78
86 0.74
87 0.7
88 0.65
89 0.58
90 0.56
91 0.56
92 0.56
93 0.56
94 0.63
95 0.59
96 0.57
97 0.57
98 0.5