FuNGI

A0A1B9GYC3

Protein Details

Accession

A0A1B9GYC3

Localization Confidence

Medium

Confidence Score

12.4

NoLS Segment(s)

Position	Sequence	Protein Nature
60-79	AVKYRDRPSLKKKVHWEWTP	Hydrophilic

NLS Segment(s)

Position	Sequence
291-293	KRK

Subcellular Location(s)

nucl 15, cyto_nucl 10, mito 9

Family & Domain DBs

InterPro	View protein in InterPro IPR032563 DAMP1_SANT-like IPR001005 SANT/Myb IPR027109 Swc4/Dmap1
Gene Ontology	GO:0035267 C:NuA4 histone acetyltransferase complex GO:0005634 C:nucleus GO:0006338 P:chromatin remodeling GO:0006281 P:DNA repair GO:0043968 P:histone H2A acetylation GO:0043967 P:histone H4 acetylation
Pfam	View protein in Pfam PF16282 SANT_DAMP1_like

Amino Acid Sequences

MTSQDIRSILNLPQAGPSTSAPKKVSSSAARKPDGISRELYALIGDNAPSLAQAQASLAAVKYRDRPSLKKKVHWEWTPFTPAARRDNPVRLGHWTRITDADPESIEYFGKFNLQSPSVMEYSQFEYDQHLQDSDWTSQETSYLFDLLKQYDLRFIIVADRYEYKSPTGQTKKRSVEELKDRYYTICRRLIRTRTASDPTAQQQLIHAYNFDKSREIKRKQYASELFHLTAAEIAEEEALYIEIKRMEQNERRYRADRDDLMRTVMGFDSGLITLDQSNVDNILGVDKNKKRKRMEEGEPAVQEPPPPKTAKDSAAFDAAHCIYRLPPPPSNPQSSHLASKHPVHQAVHLRSSKLPLPKPTAQIRITEMLSELGINATKLVMPTRGNIEMFDSLLQAAGSLIDMKRQVDRVEQELRTVRAQKEGLLPSLDANRKIRSESVASTDTSITRRSRPL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.27
2	0.26
3	0.26
4	0.25
5	0.27
6	0.3
7	0.36
8	0.34
9	0.35
10	0.38
11	0.39
12	0.45
13	0.46
14	0.52
15	0.54
16	0.62
17	0.61
18	0.59
19	0.57
20	0.56
21	0.51
22	0.44
23	0.38
24	0.31
25	0.3
26	0.29
27	0.26
28	0.2
29	0.17
30	0.15
31	0.13
32	0.11
33	0.09
34	0.09
35	0.09
36	0.08
37	0.08
38	0.07
39	0.06
40	0.06
41	0.06
42	0.08
43	0.09
44	0.09
45	0.09
46	0.1
47	0.11
48	0.14
49	0.21
50	0.24
51	0.32
52	0.37
53	0.46
54	0.54
55	0.64
56	0.69
57	0.7
58	0.75
59	0.77
60	0.81
61	0.8
62	0.77
63	0.72
64	0.71
65	0.68
66	0.59
67	0.51
68	0.48
69	0.45
70	0.46
71	0.44
72	0.42
73	0.42
74	0.49
75	0.53
76	0.51
77	0.48
78	0.48
79	0.48
80	0.5
81	0.5
82	0.44
83	0.39
84	0.38
85	0.37
86	0.32
87	0.28
88	0.25
89	0.19
90	0.2
91	0.19
92	0.16
93	0.15
94	0.13
95	0.12
96	0.1
97	0.13
98	0.11
99	0.13
100	0.17
101	0.18
102	0.18
103	0.19
104	0.23
105	0.2
106	0.2
107	0.17
108	0.15
109	0.17
110	0.19
111	0.17
112	0.13
113	0.17
114	0.21
115	0.23
116	0.21
117	0.18
118	0.16
119	0.19
120	0.23
121	0.19
122	0.17
123	0.15
124	0.15
125	0.14
126	0.15
127	0.12
128	0.11
129	0.1
130	0.1
131	0.09
132	0.11
133	0.13
134	0.13
135	0.15
136	0.15
137	0.14
138	0.17
139	0.18
140	0.16
141	0.14
142	0.14
143	0.15
144	0.16
145	0.16
146	0.14
147	0.16
148	0.18
149	0.19
150	0.2
151	0.17
152	0.19
153	0.2
154	0.28
155	0.35
156	0.38
157	0.44
158	0.52
159	0.56
160	0.55
161	0.6
162	0.54
163	0.54
164	0.59
165	0.59
166	0.54
167	0.49
168	0.48
169	0.42
170	0.45
171	0.4
172	0.36
173	0.36
174	0.34
175	0.38
176	0.45
177	0.5
178	0.51
179	0.52
180	0.49
181	0.47
182	0.49
183	0.45
184	0.38
185	0.36
186	0.3
187	0.3
188	0.27
189	0.21
190	0.19
191	0.21
192	0.21
193	0.17
194	0.16
195	0.11
196	0.15
197	0.16
198	0.15
199	0.14
200	0.16
201	0.25
202	0.34
203	0.38
204	0.44
205	0.5
206	0.55
207	0.54
208	0.61
209	0.57
210	0.51
211	0.51
212	0.46
213	0.38
214	0.33
215	0.31
216	0.22
217	0.16
218	0.12
219	0.08
220	0.05
221	0.04
222	0.04
223	0.04
224	0.04
225	0.03
226	0.03
227	0.03
228	0.03
229	0.04
230	0.05
231	0.05
232	0.07
233	0.09
234	0.16
235	0.22
236	0.33
237	0.41
238	0.45
239	0.49
240	0.51
241	0.52
242	0.51
243	0.51
244	0.45
245	0.4
246	0.41
247	0.37
248	0.35
249	0.32
250	0.26
251	0.21
252	0.16
253	0.12
254	0.07
255	0.06
256	0.06
257	0.06
258	0.06
259	0.05
260	0.05
261	0.05
262	0.06
263	0.06
264	0.05
265	0.06
266	0.06
267	0.05
268	0.05
269	0.05
270	0.07
271	0.08
272	0.09
273	0.17
274	0.21
275	0.32
276	0.37
277	0.46
278	0.49
279	0.55
280	0.64
281	0.65
282	0.69
283	0.69
284	0.7
285	0.68
286	0.63
287	0.56
288	0.47
289	0.38
290	0.32
291	0.23
292	0.2
293	0.19
294	0.19
295	0.19
296	0.25
297	0.29
298	0.32
299	0.35
300	0.35
301	0.33
302	0.36
303	0.35
304	0.29
305	0.29
306	0.25
307	0.21
308	0.17
309	0.16
310	0.13
311	0.19
312	0.25
313	0.26
314	0.29
315	0.33
316	0.43
317	0.48
318	0.53
319	0.5
320	0.47
321	0.48
322	0.47
323	0.5
324	0.41
325	0.4
326	0.38
327	0.39
328	0.43
329	0.41
330	0.42
331	0.36
332	0.41
333	0.46
334	0.48
335	0.52
336	0.47
337	0.44
338	0.42
339	0.45
340	0.43
341	0.41
342	0.42
343	0.4
344	0.46
345	0.5
346	0.55
347	0.59
348	0.62
349	0.55
350	0.52
351	0.5
352	0.46
353	0.4
354	0.34
355	0.27
356	0.2
357	0.18
358	0.15
359	0.11
360	0.08
361	0.08
362	0.07
363	0.07
364	0.06
365	0.07
366	0.08
367	0.09
368	0.12
369	0.13
370	0.15
371	0.2
372	0.24
373	0.23
374	0.23
375	0.25
376	0.22
377	0.22
378	0.2
379	0.15
380	0.12
381	0.12
382	0.11
383	0.07
384	0.06
385	0.05
386	0.05
387	0.07
388	0.08
389	0.11
390	0.12
391	0.14
392	0.17
393	0.2
394	0.22
395	0.26
396	0.3
397	0.33
398	0.4
399	0.39
400	0.42
401	0.44
402	0.46
403	0.45
404	0.48
405	0.43
406	0.42
407	0.42
408	0.39
409	0.42
410	0.43
411	0.39
412	0.35
413	0.34
414	0.3
415	0.38
416	0.39
417	0.36
418	0.36
419	0.38
420	0.38
421	0.4
422	0.4
423	0.36
424	0.37
425	0.35
426	0.38
427	0.36
428	0.35
429	0.34
430	0.33
431	0.31
432	0.28
433	0.3
434	0.28

A0A1B9GYC3

3D AlphaFold-predicted Structure Viewer