Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B9H4C1

Protein Details
Accession A0A1B9H4C1    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MYEHDRRKSPWRLSPTRKANQRKRLKNVDNVIHydrophilic
NLS Segment(s)
PositionSequence
11-24WRLSPTRKANQRKR
Subcellular Location(s) nucl 18, cyto 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MYEHDRRKSPWRLSPTRKANQRKRLKNVDNVISAIAESGVEIRSLGKALELPTEAEMRPKVVDCLLEEREICQNKICQNEIGAAGDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.83
4 0.84
5 0.86
6 0.86
7 0.86
8 0.88
9 0.87
10 0.86
11 0.88
12 0.85
13 0.83
14 0.79
15 0.75
16 0.66
17 0.56
18 0.47
19 0.36
20 0.29
21 0.2
22 0.12
23 0.06
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.04
31 0.05
32 0.05
33 0.04
34 0.05
35 0.06
36 0.08
37 0.08
38 0.08
39 0.09
40 0.11
41 0.11
42 0.13
43 0.12
44 0.12
45 0.13
46 0.12
47 0.12
48 0.12
49 0.13
50 0.13
51 0.19
52 0.19
53 0.21
54 0.2
55 0.21
56 0.28
57 0.3
58 0.28
59 0.26
60 0.28
61 0.31
62 0.37
63 0.37
64 0.31
65 0.29
66 0.32
67 0.3