Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9IU56

Protein Details
Accession A0A1B9IU56   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
287-321LPRIERQWRKDERLIKRRREKRRRLREGELRLSRVBasic
NLS Segment(s)
PositionSequence
292-313RQWRKDERLIKRRREKRRRLRE
Subcellular Location(s) nucl 18, cyto 5, mito 1, plas 1, pero 1, cysk 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR028018  DUF4646  
Pfam View protein in Pfam  
PF15496  DUF4646  
Amino Acid Sequences MPFGLPFIARPGQEGFDQYGRMLPPDLPEGWDGWGRPLVSTNPAPNAPPGGPGGPLPPPAPAAAQAAGVPPQPTATQTQQMPFSSSYGTSSMTGTGSRSMSSTLSSNGTGRPDQPPCFDRPPAKSDSYFRYDAFQPFSLPCSSLNYPHQLHLPPELVSHDVNEEDWSRFIDDLSQEALTNARHPLHLHARGGRGMGPEPVLSEAVHSLLASWAVAFFSPRGIKIYAASEESNERILPPPIEPPPLKRGYSHADEWSDEEYSSNDEYNFHDLSEDEEERYQRKKDMYLPRIERQWRKDERLIKRRREKRRRLREGELRLSRVVGNWEIHFICSTPTIWQQGARPRGYGEPVIRSRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.24
4 0.25
5 0.23
6 0.24
7 0.22
8 0.22
9 0.21
10 0.18
11 0.18
12 0.21
13 0.22
14 0.2
15 0.2
16 0.2
17 0.2
18 0.22
19 0.19
20 0.18
21 0.21
22 0.19
23 0.19
24 0.21
25 0.2
26 0.24
27 0.28
28 0.28
29 0.29
30 0.3
31 0.31
32 0.29
33 0.31
34 0.25
35 0.23
36 0.22
37 0.18
38 0.18
39 0.17
40 0.19
41 0.17
42 0.19
43 0.17
44 0.16
45 0.16
46 0.16
47 0.16
48 0.15
49 0.16
50 0.14
51 0.14
52 0.13
53 0.13
54 0.14
55 0.14
56 0.13
57 0.1
58 0.1
59 0.1
60 0.12
61 0.16
62 0.18
63 0.23
64 0.24
65 0.27
66 0.3
67 0.31
68 0.32
69 0.28
70 0.25
71 0.21
72 0.19
73 0.18
74 0.15
75 0.16
76 0.13
77 0.13
78 0.13
79 0.12
80 0.12
81 0.11
82 0.13
83 0.12
84 0.11
85 0.11
86 0.12
87 0.11
88 0.12
89 0.13
90 0.12
91 0.13
92 0.14
93 0.14
94 0.15
95 0.17
96 0.17
97 0.18
98 0.22
99 0.25
100 0.27
101 0.3
102 0.31
103 0.34
104 0.38
105 0.41
106 0.4
107 0.4
108 0.43
109 0.43
110 0.44
111 0.4
112 0.39
113 0.41
114 0.4
115 0.38
116 0.33
117 0.32
118 0.32
119 0.31
120 0.31
121 0.26
122 0.22
123 0.2
124 0.22
125 0.19
126 0.17
127 0.15
128 0.17
129 0.17
130 0.2
131 0.22
132 0.25
133 0.26
134 0.26
135 0.28
136 0.24
137 0.24
138 0.23
139 0.22
140 0.16
141 0.16
142 0.16
143 0.14
144 0.13
145 0.12
146 0.1
147 0.08
148 0.08
149 0.09
150 0.09
151 0.08
152 0.09
153 0.09
154 0.09
155 0.09
156 0.08
157 0.09
158 0.08
159 0.08
160 0.09
161 0.09
162 0.08
163 0.08
164 0.09
165 0.07
166 0.08
167 0.09
168 0.08
169 0.09
170 0.09
171 0.14
172 0.2
173 0.24
174 0.24
175 0.26
176 0.27
177 0.27
178 0.27
179 0.24
180 0.18
181 0.15
182 0.14
183 0.12
184 0.1
185 0.1
186 0.1
187 0.09
188 0.07
189 0.07
190 0.07
191 0.06
192 0.06
193 0.06
194 0.05
195 0.05
196 0.05
197 0.04
198 0.04
199 0.03
200 0.03
201 0.04
202 0.04
203 0.04
204 0.07
205 0.08
206 0.09
207 0.12
208 0.12
209 0.13
210 0.14
211 0.17
212 0.15
213 0.16
214 0.16
215 0.15
216 0.16
217 0.16
218 0.15
219 0.12
220 0.12
221 0.11
222 0.13
223 0.13
224 0.12
225 0.16
226 0.18
227 0.24
228 0.24
229 0.26
230 0.33
231 0.36
232 0.36
233 0.32
234 0.35
235 0.35
236 0.4
237 0.38
238 0.35
239 0.32
240 0.32
241 0.33
242 0.3
243 0.25
244 0.19
245 0.16
246 0.13
247 0.13
248 0.14
249 0.13
250 0.11
251 0.11
252 0.13
253 0.17
254 0.17
255 0.14
256 0.13
257 0.13
258 0.16
259 0.21
260 0.19
261 0.16
262 0.19
263 0.21
264 0.23
265 0.28
266 0.27
267 0.25
268 0.27
269 0.3
270 0.37
271 0.47
272 0.52
273 0.58
274 0.63
275 0.64
276 0.7
277 0.74
278 0.73
279 0.68
280 0.71
281 0.69
282 0.7
283 0.72
284 0.73
285 0.76
286 0.78
287 0.81
288 0.82
289 0.84
290 0.86
291 0.9
292 0.91
293 0.92
294 0.92
295 0.94
296 0.94
297 0.92
298 0.92
299 0.91
300 0.9
301 0.9
302 0.86
303 0.78
304 0.67
305 0.61
306 0.51
307 0.42
308 0.36
309 0.3
310 0.25
311 0.22
312 0.26
313 0.25
314 0.25
315 0.24
316 0.2
317 0.17
318 0.16
319 0.16
320 0.15
321 0.19
322 0.23
323 0.23
324 0.26
325 0.31
326 0.39
327 0.46
328 0.44
329 0.41
330 0.4
331 0.43
332 0.44
333 0.45
334 0.4
335 0.42