Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B9IGZ5

Protein Details
Accession A0A1B9IGZ5    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
46-71DDVDGTKKSKKKRRKKGGKGLSSGSWBasic
NLS Segment(s)
PositionSequence
52-65KKSKKKRRKKGGKG
Subcellular Location(s) mito 16, nucl 10.5, cyto_nucl 6
Family & Domain DBs
Amino Acid Sequences MPLLSLISTIKVKPIHKRTYPLGDSGGSPTQTLRLRGGCASASNIDDVDGTKKSKKKRRKKGGKGLSSGSWMGCGGGGC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.51
3 0.54
4 0.6
5 0.6
6 0.65
7 0.62
8 0.54
9 0.47
10 0.39
11 0.34
12 0.33
13 0.29
14 0.19
15 0.18
16 0.15
17 0.18
18 0.19
19 0.2
20 0.18
21 0.17
22 0.18
23 0.18
24 0.19
25 0.14
26 0.12
27 0.12
28 0.11
29 0.1
30 0.09
31 0.09
32 0.08
33 0.08
34 0.08
35 0.09
36 0.09
37 0.11
38 0.17
39 0.22
40 0.31
41 0.41
42 0.51
43 0.6
44 0.7
45 0.79
46 0.85
47 0.92
48 0.94
49 0.95
50 0.94
51 0.88
52 0.82
53 0.73
54 0.65
55 0.55
56 0.43
57 0.34
58 0.24
59 0.18