Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7YLD3

Protein Details
Accession C7YLD3    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
8-46KLINNHFRKDWQRRVRTHFDQPGKKSRRRTARQAKAAALHydrophilic
NLS Segment(s)
PositionSequence
29-49PGKKSRRRTARQAKAAALAPR
Subcellular Location(s) nucl 20, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001380  Ribosomal_L13e  
IPR018256  Ribosomal_L13e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG nhe:NECHADRAFT_58831  -  
Pfam View protein in Pfam  
PF01294  Ribosomal_L13e  
PROSITE View protein in PROSITE  
PS01104  RIBOSOMAL_L13E  
Amino Acid Sequences MAIKHNQKLINNHFRKDWQRRVRTHFDQPGKKSRRRTARQAKAAALAPRPVDKLRPVVRCPTIKYNRRVRAGRGFTLAELKEAGIPKAFAPTIGISVDSRRQNLSEESLAANVARLKAYQERLILLPRRSNAPKKGDTKTDVSQIEKASTISAVLPIAPTDIAFKEISKSEIPAALKEGAYRTLRVARSNARYEGARQKRVRDAAEAETAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.68
3 0.69
4 0.69
5 0.69
6 0.73
7 0.79
8 0.83
9 0.85
10 0.82
11 0.82
12 0.81
13 0.8
14 0.79
15 0.78
16 0.8
17 0.78
18 0.78
19 0.77
20 0.77
21 0.78
22 0.77
23 0.81
24 0.81
25 0.84
26 0.86
27 0.82
28 0.75
29 0.68
30 0.65
31 0.58
32 0.49
33 0.41
34 0.33
35 0.3
36 0.31
37 0.27
38 0.25
39 0.24
40 0.3
41 0.35
42 0.4
43 0.41
44 0.45
45 0.51
46 0.52
47 0.54
48 0.56
49 0.58
50 0.6
51 0.65
52 0.69
53 0.7
54 0.74
55 0.72
56 0.67
57 0.67
58 0.64
59 0.58
60 0.51
61 0.44
62 0.36
63 0.38
64 0.32
65 0.22
66 0.17
67 0.15
68 0.14
69 0.14
70 0.14
71 0.09
72 0.09
73 0.09
74 0.11
75 0.11
76 0.08
77 0.09
78 0.09
79 0.1
80 0.09
81 0.1
82 0.08
83 0.09
84 0.15
85 0.15
86 0.15
87 0.15
88 0.15
89 0.16
90 0.17
91 0.19
92 0.14
93 0.13
94 0.13
95 0.12
96 0.12
97 0.1
98 0.09
99 0.07
100 0.07
101 0.06
102 0.06
103 0.08
104 0.12
105 0.14
106 0.16
107 0.16
108 0.17
109 0.18
110 0.24
111 0.27
112 0.25
113 0.26
114 0.24
115 0.29
116 0.33
117 0.39
118 0.41
119 0.43
120 0.48
121 0.51
122 0.54
123 0.54
124 0.53
125 0.52
126 0.47
127 0.47
128 0.41
129 0.38
130 0.37
131 0.32
132 0.3
133 0.25
134 0.22
135 0.15
136 0.13
137 0.11
138 0.08
139 0.08
140 0.07
141 0.06
142 0.06
143 0.06
144 0.06
145 0.06
146 0.06
147 0.07
148 0.07
149 0.1
150 0.1
151 0.1
152 0.12
153 0.13
154 0.16
155 0.15
156 0.16
157 0.15
158 0.19
159 0.2
160 0.19
161 0.21
162 0.2
163 0.2
164 0.19
165 0.2
166 0.21
167 0.22
168 0.22
169 0.22
170 0.27
171 0.29
172 0.31
173 0.36
174 0.38
175 0.44
176 0.49
177 0.48
178 0.43
179 0.43
180 0.46
181 0.51
182 0.52
183 0.54
184 0.52
185 0.56
186 0.62
187 0.67
188 0.64
189 0.59
190 0.54
191 0.49
192 0.55