Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9IHQ3

Protein Details
Accession A0A1B9IHQ3   
Localization Confidence High
Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
46-79AGQIQKSQKKHSKNKQVSKKQKARNEKGKERAIEHydrophilic
82-106EKLGNKVKEREEKKAKRQRAKKAWEBasic
NLS Segment(s)
PositionSequence
52-105SQKKHSKNKQVSKKQKARNEKGKERAIELSEKLGNKVKEREEKKAKRQRAKKAW
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR022784  Ribosome_bgen_Alb1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF09135  Alb1  
Amino Acid Sequences MSGNNEAGPSTSVPSFPSGGNDSGIPVQPSKIAKNARLPATMINPAGQIQKSQKKHSKNKQVSKKQKARNEKGKERAIELSEKLGNKVKEREEKKAKRQRAKKAWE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.15
4 0.18
5 0.18
6 0.19
7 0.19
8 0.18
9 0.17
10 0.17
11 0.18
12 0.16
13 0.13
14 0.12
15 0.15
16 0.17
17 0.17
18 0.22
19 0.25
20 0.28
21 0.36
22 0.41
23 0.4
24 0.39
25 0.38
26 0.34
27 0.34
28 0.33
29 0.24
30 0.19
31 0.16
32 0.16
33 0.17
34 0.15
35 0.13
36 0.17
37 0.25
38 0.27
39 0.35
40 0.41
41 0.48
42 0.59
43 0.67
44 0.72
45 0.74
46 0.81
47 0.84
48 0.88
49 0.9
50 0.9
51 0.9
52 0.87
53 0.86
54 0.87
55 0.86
56 0.86
57 0.85
58 0.83
59 0.83
60 0.81
61 0.73
62 0.66
63 0.6
64 0.52
65 0.46
66 0.37
67 0.33
68 0.3
69 0.29
70 0.28
71 0.3
72 0.3
73 0.31
74 0.37
75 0.4
76 0.46
77 0.51
78 0.59
79 0.64
80 0.72
81 0.78
82 0.82
83 0.85
84 0.85
85 0.9
86 0.91