Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B9IQE3

Protein Details
Accession A0A1B9IQE3    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
44-67GGKERLAKLKSKKNKGYEKVESERBasic
NLS Segment(s)
PositionSequence
48-58RLAKLKSKKNK
Subcellular Location(s) E.R. 8, cyto 7, cyto_nucl 6, extr 4, nucl 3, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDEPDSDHDLLESYPTLSSPLKYFILLVGFMVIPVGLGVYFYGGGKERLAKLKSKKNKGYEKVESERV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.11
4 0.11
5 0.12
6 0.12
7 0.15
8 0.15
9 0.15
10 0.15
11 0.13
12 0.14
13 0.12
14 0.11
15 0.08
16 0.07
17 0.06
18 0.06
19 0.05
20 0.03
21 0.03
22 0.03
23 0.02
24 0.02
25 0.02
26 0.02
27 0.03
28 0.03
29 0.04
30 0.05
31 0.06
32 0.07
33 0.1
34 0.13
35 0.2
36 0.22
37 0.29
38 0.37
39 0.47
40 0.57
41 0.65
42 0.71
43 0.73
44 0.82
45 0.83
46 0.84
47 0.83
48 0.82