Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9IRR9

Protein Details
Accession A0A1B9IRR9    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
74-99MAVYLRYLNRRQRKKRERMGRMVDIQHydrophilic
NLS Segment(s)
PositionSequence
84-90RQRKKRE
Subcellular Location(s) mito 10, cyto 7, nucl 5, plas 4, cyto_pero 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLYTPLQPLVYSWANMNSAGITKQRTLGAILFIFQCAGNVAGPQVYLEEAPIYRTGLYTDMSCWALLFTLICSMAVYLRYLNRRQRKKRERMGRMVDIQDMSIMTLEEAAAYKRELAAAGEGHDINAHAFDDLSDLQNPEFHCIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.2
4 0.14
5 0.13
6 0.15
7 0.16
8 0.16
9 0.16
10 0.19
11 0.19
12 0.19
13 0.2
14 0.19
15 0.2
16 0.17
17 0.17
18 0.15
19 0.14
20 0.14
21 0.11
22 0.1
23 0.07
24 0.07
25 0.06
26 0.06
27 0.06
28 0.06
29 0.06
30 0.06
31 0.05
32 0.05
33 0.05
34 0.05
35 0.06
36 0.05
37 0.07
38 0.07
39 0.08
40 0.07
41 0.07
42 0.08
43 0.08
44 0.09
45 0.08
46 0.08
47 0.09
48 0.1
49 0.1
50 0.09
51 0.07
52 0.07
53 0.06
54 0.06
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.05
62 0.05
63 0.05
64 0.06
65 0.09
66 0.13
67 0.19
68 0.27
69 0.36
70 0.47
71 0.56
72 0.67
73 0.74
74 0.81
75 0.86
76 0.88
77 0.88
78 0.87
79 0.86
80 0.81
81 0.75
82 0.66
83 0.57
84 0.46
85 0.37
86 0.28
87 0.19
88 0.13
89 0.08
90 0.07
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.05
97 0.06
98 0.06
99 0.07
100 0.07
101 0.07
102 0.07
103 0.08
104 0.1
105 0.1
106 0.11
107 0.13
108 0.13
109 0.13
110 0.13
111 0.12
112 0.1
113 0.1
114 0.08
115 0.06
116 0.06
117 0.06
118 0.09
119 0.1
120 0.12
121 0.13
122 0.14
123 0.14
124 0.17
125 0.18