Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9J2A4

Protein Details
Accession A0A1B9J2A4    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
16-41MAGSKAGKKKKWSKGKVKDKANNAVVHydrophilic
NLS Segment(s)
PositionSequence
11-35KAAAAMAGSKAGKKKKWSKGKVKDK
Subcellular Location(s) mito 12, cyto 8, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPPQVKSKAQKAAAAMAGSKAGKKKKWSKGKVKDKANNAVVLDKAVYDRILKEVPTYKLISQSVLIDRMKINGSLARRAIAFLEKEGHIKRVVHHHAQLIYTRATAAKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.33
3 0.24
4 0.24
5 0.21
6 0.21
7 0.22
8 0.25
9 0.29
10 0.39
11 0.48
12 0.56
13 0.66
14 0.74
15 0.79
16 0.84
17 0.9
18 0.9
19 0.91
20 0.87
21 0.83
22 0.82
23 0.73
24 0.65
25 0.54
26 0.47
27 0.36
28 0.29
29 0.22
30 0.13
31 0.11
32 0.08
33 0.08
34 0.06
35 0.07
36 0.09
37 0.09
38 0.09
39 0.11
40 0.16
41 0.17
42 0.19
43 0.2
44 0.18
45 0.22
46 0.22
47 0.21
48 0.17
49 0.17
50 0.16
51 0.19
52 0.18
53 0.15
54 0.15
55 0.16
56 0.16
57 0.14
58 0.14
59 0.13
60 0.15
61 0.18
62 0.18
63 0.18
64 0.17
65 0.17
66 0.17
67 0.18
68 0.17
69 0.14
70 0.17
71 0.16
72 0.21
73 0.22
74 0.23
75 0.23
76 0.23
77 0.25
78 0.32
79 0.38
80 0.39
81 0.42
82 0.44
83 0.44
84 0.45
85 0.45
86 0.38
87 0.32
88 0.26
89 0.24