Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9J0F7

Protein Details
Accession A0A1B9J0F7   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
16-41LWKTPWRLSPTRKANQRKRLKQVDSVHydrophilic
74-97TTFSKHHRGYRKSQHKVPKWTRLTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 5.5, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRQSSILSGGLLWKTPWRLSPTRKANQRKRLKQVDSVISAVAQSGVTTRSLEKALALPMESEMNPRDKYTTFSKHHRGYRKSQHKVPKWTRLTLRENPKGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.13
4 0.15
5 0.17
6 0.18
7 0.23
8 0.26
9 0.34
10 0.4
11 0.5
12 0.57
13 0.62
14 0.71
15 0.77
16 0.8
17 0.83
18 0.87
19 0.86
20 0.86
21 0.87
22 0.81
23 0.78
24 0.75
25 0.7
26 0.62
27 0.53
28 0.43
29 0.32
30 0.28
31 0.2
32 0.13
33 0.07
34 0.04
35 0.04
36 0.04
37 0.05
38 0.06
39 0.06
40 0.07
41 0.08
42 0.08
43 0.08
44 0.08
45 0.09
46 0.09
47 0.09
48 0.07
49 0.08
50 0.09
51 0.09
52 0.09
53 0.1
54 0.14
55 0.14
56 0.14
57 0.16
58 0.15
59 0.19
60 0.25
61 0.33
62 0.34
63 0.42
64 0.51
65 0.56
66 0.64
67 0.7
68 0.68
69 0.69
70 0.76
71 0.78
72 0.78
73 0.79
74 0.81
75 0.81
76 0.86
77 0.85
78 0.85
79 0.8
80 0.8
81 0.8
82 0.78
83 0.77
84 0.75
85 0.76