Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9J1J3

Protein Details
Accession A0A1B9J1J3   
Localization Confidence Low
Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
28-54NAPSGFVKRQKQLRKKRLSQEKYEYCPHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 13.5, cyto_nucl 13, nucl 9.5, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR038955  PriA/CPL1_fungi  
Amino Acid Sequences MDVGPQSVNCGPDVWSTFQHTSGDFVANAPSGFVKRQKQLRKKRLSQEKYEYCPAGLKACKVPGDELAFECLNVNTELESCGGCLYGDYGVGLNAPGGSYGVDCTSLPGVAMGAITCTSGQCTAFACEEGYELTRENSTCVSLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.28
4 0.29
5 0.3
6 0.29
7 0.25
8 0.24
9 0.23
10 0.22
11 0.16
12 0.15
13 0.14
14 0.14
15 0.13
16 0.11
17 0.1
18 0.1
19 0.12
20 0.18
21 0.23
22 0.29
23 0.38
24 0.49
25 0.58
26 0.68
27 0.76
28 0.8
29 0.84
30 0.87
31 0.89
32 0.86
33 0.84
34 0.83
35 0.8
36 0.75
37 0.71
38 0.61
39 0.5
40 0.45
41 0.37
42 0.32
43 0.25
44 0.21
45 0.19
46 0.22
47 0.23
48 0.21
49 0.21
50 0.19
51 0.2
52 0.19
53 0.17
54 0.17
55 0.16
56 0.15
57 0.14
58 0.1
59 0.09
60 0.08
61 0.08
62 0.05
63 0.05
64 0.06
65 0.06
66 0.06
67 0.05
68 0.05
69 0.05
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.04
86 0.04
87 0.04
88 0.05
89 0.06
90 0.06
91 0.07
92 0.08
93 0.08
94 0.07
95 0.07
96 0.06
97 0.05
98 0.06
99 0.04
100 0.04
101 0.04
102 0.05
103 0.05
104 0.05
105 0.06
106 0.08
107 0.08
108 0.08
109 0.1
110 0.12
111 0.13
112 0.14
113 0.14
114 0.12
115 0.13
116 0.14
117 0.13
118 0.12
119 0.12
120 0.13
121 0.15
122 0.15
123 0.16
124 0.16