Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B9IYM5

Protein Details
Accession A0A1B9IYM5    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
100-120KGGNGNTTPKKRKVKEEEEDEBasic
NLS Segment(s)
PositionSequence
108-112PKKRK
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MPPKVEKKSWNDDHTAILLRGIIRQSLIHRSDIYQLPGLEGVSENGGDRINKKLQSILKKLSEKYPGMVDEELKSLGRSRTKNGNSNGITTPTSSPKKDKGGNGNTTPKKRKVKEEEEDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.45
3 0.35
4 0.26
5 0.23
6 0.18
7 0.19
8 0.17
9 0.14
10 0.11
11 0.13
12 0.16
13 0.22
14 0.23
15 0.23
16 0.23
17 0.24
18 0.29
19 0.3
20 0.29
21 0.24
22 0.23
23 0.21
24 0.21
25 0.19
26 0.14
27 0.11
28 0.09
29 0.06
30 0.06
31 0.06
32 0.06
33 0.07
34 0.07
35 0.08
36 0.12
37 0.15
38 0.17
39 0.17
40 0.21
41 0.26
42 0.34
43 0.38
44 0.38
45 0.41
46 0.44
47 0.44
48 0.44
49 0.44
50 0.37
51 0.33
52 0.3
53 0.24
54 0.23
55 0.22
56 0.18
57 0.14
58 0.14
59 0.14
60 0.11
61 0.11
62 0.11
63 0.15
64 0.2
65 0.21
66 0.24
67 0.34
68 0.39
69 0.47
70 0.47
71 0.53
72 0.48
73 0.5
74 0.48
75 0.4
76 0.35
77 0.29
78 0.29
79 0.28
80 0.31
81 0.3
82 0.34
83 0.37
84 0.45
85 0.49
86 0.53
87 0.56
88 0.61
89 0.66
90 0.68
91 0.73
92 0.74
93 0.77
94 0.78
95 0.77
96 0.78
97 0.76
98 0.79
99 0.79
100 0.81