Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9IU10

Protein Details
Accession A0A1B9IU10   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
328-357DQDNNEKDKDKDRERKRGNRRGHGNGPGTSBasic
NLS Segment(s)
PositionSequence
336-350KDKDRERKRGNRRGH
Subcellular Location(s) nucl 19, cyto_nucl 14, cyto 7
Family & Domain DBs
Amino Acid Sequences MDLSTLGSTLPPGLADAERDMGDKFRAAALSITNLYKSSLGYTKQAYNVGYSAALADVLSTVQSSIGAGQDAEQTLSRLMDWADARQAAISAFAAEDTDDLPVPAPITKRPTAIPRNSHLNPINRPASAPIPSQPSTTSKADSQPIASTSRNVQPLPSTSNTTTPSTNTLVSPSVAGYQPTPGGVMSSSPMASPSNNHHRSNFSALPKPSKNLPSRYSQLNLNASGSGTSSGHVPSTTFDPTLPSAGVPFVSFTNNTNASDEGPAQNYPTGTKRPMIDSMEIDQVIPIPPSSTNTSVTAVPVAIQTPPNRSGRSAKRRSMGNNLGANDQDNNEKDKDKDRERKRGNRRGHGNGPGTSAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.13
4 0.15
5 0.15
6 0.16
7 0.16
8 0.16
9 0.17
10 0.16
11 0.15
12 0.15
13 0.15
14 0.15
15 0.16
16 0.15
17 0.18
18 0.2
19 0.2
20 0.18
21 0.18
22 0.19
23 0.18
24 0.16
25 0.16
26 0.19
27 0.2
28 0.24
29 0.27
30 0.3
31 0.33
32 0.36
33 0.32
34 0.29
35 0.27
36 0.24
37 0.2
38 0.16
39 0.13
40 0.09
41 0.09
42 0.06
43 0.05
44 0.05
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.05
53 0.06
54 0.06
55 0.06
56 0.07
57 0.09
58 0.1
59 0.1
60 0.1
61 0.1
62 0.1
63 0.11
64 0.1
65 0.08
66 0.08
67 0.12
68 0.13
69 0.13
70 0.16
71 0.16
72 0.16
73 0.15
74 0.15
75 0.1
76 0.1
77 0.09
78 0.06
79 0.06
80 0.05
81 0.05
82 0.05
83 0.05
84 0.05
85 0.06
86 0.05
87 0.05
88 0.06
89 0.06
90 0.06
91 0.08
92 0.09
93 0.12
94 0.18
95 0.2
96 0.21
97 0.24
98 0.33
99 0.39
100 0.46
101 0.48
102 0.46
103 0.54
104 0.53
105 0.58
106 0.54
107 0.52
108 0.47
109 0.49
110 0.47
111 0.38
112 0.38
113 0.33
114 0.3
115 0.26
116 0.24
117 0.2
118 0.24
119 0.24
120 0.25
121 0.24
122 0.24
123 0.27
124 0.27
125 0.26
126 0.22
127 0.25
128 0.26
129 0.25
130 0.23
131 0.19
132 0.2
133 0.21
134 0.19
135 0.17
136 0.18
137 0.22
138 0.23
139 0.22
140 0.2
141 0.19
142 0.21
143 0.25
144 0.23
145 0.22
146 0.2
147 0.25
148 0.27
149 0.27
150 0.25
151 0.21
152 0.22
153 0.2
154 0.2
155 0.16
156 0.15
157 0.13
158 0.13
159 0.12
160 0.09
161 0.09
162 0.09
163 0.09
164 0.07
165 0.08
166 0.07
167 0.07
168 0.07
169 0.05
170 0.05
171 0.05
172 0.05
173 0.05
174 0.05
175 0.05
176 0.05
177 0.06
178 0.06
179 0.07
180 0.08
181 0.14
182 0.24
183 0.3
184 0.31
185 0.32
186 0.34
187 0.37
188 0.42
189 0.41
190 0.34
191 0.36
192 0.36
193 0.42
194 0.41
195 0.4
196 0.38
197 0.4
198 0.42
199 0.42
200 0.43
201 0.42
202 0.44
203 0.46
204 0.43
205 0.38
206 0.38
207 0.34
208 0.32
209 0.27
210 0.24
211 0.2
212 0.18
213 0.15
214 0.11
215 0.08
216 0.07
217 0.07
218 0.07
219 0.08
220 0.07
221 0.07
222 0.07
223 0.1
224 0.12
225 0.11
226 0.11
227 0.13
228 0.14
229 0.15
230 0.14
231 0.11
232 0.1
233 0.1
234 0.1
235 0.07
236 0.08
237 0.07
238 0.08
239 0.09
240 0.1
241 0.16
242 0.17
243 0.18
244 0.18
245 0.18
246 0.18
247 0.19
248 0.19
249 0.15
250 0.15
251 0.14
252 0.14
253 0.15
254 0.14
255 0.15
256 0.18
257 0.2
258 0.21
259 0.24
260 0.25
261 0.27
262 0.32
263 0.33
264 0.32
265 0.31
266 0.32
267 0.32
268 0.3
269 0.26
270 0.21
271 0.18
272 0.16
273 0.14
274 0.11
275 0.08
276 0.08
277 0.12
278 0.17
279 0.18
280 0.2
281 0.22
282 0.23
283 0.23
284 0.23
285 0.2
286 0.16
287 0.14
288 0.12
289 0.1
290 0.1
291 0.14
292 0.15
293 0.2
294 0.25
295 0.3
296 0.3
297 0.33
298 0.41
299 0.48
300 0.57
301 0.62
302 0.63
303 0.65
304 0.7
305 0.72
306 0.73
307 0.7
308 0.67
309 0.64
310 0.58
311 0.55
312 0.48
313 0.44
314 0.36
315 0.29
316 0.26
317 0.22
318 0.25
319 0.26
320 0.28
321 0.3
322 0.37
323 0.46
324 0.5
325 0.59
326 0.65
327 0.73
328 0.81
329 0.89
330 0.9
331 0.91
332 0.9
333 0.91
334 0.9
335 0.89
336 0.87
337 0.86
338 0.8
339 0.73