Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9IFE8

Protein Details
Accession A0A1B9IFE8   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
3-34NSSNRTRRTYCKAKACKKHTPHKVTQYKKGKDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MLNSSNRTRRTYCKAKACKKHTPHKVTQYKKGKDSLAAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTICKTKHQLSLKRCKHFELGGDKKQRGAAISF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.8
3 0.86
4 0.86
5 0.86
6 0.85
7 0.87
8 0.86
9 0.85
10 0.84
11 0.84
12 0.86
13 0.82
14 0.84
15 0.84
16 0.79
17 0.74
18 0.7
19 0.6
20 0.54
21 0.51
22 0.5
23 0.5
24 0.48
25 0.48
26 0.49
27 0.52
28 0.55
29 0.56
30 0.52
31 0.52
32 0.57
33 0.58
34 0.6
35 0.59
36 0.57
37 0.57
38 0.59
39 0.5
40 0.44
41 0.4
42 0.33
43 0.35
44 0.36
45 0.35
46 0.3
47 0.37
48 0.41
49 0.5
50 0.58
51 0.61
52 0.61
53 0.64
54 0.71
55 0.72
56 0.71
57 0.67
58 0.62
59 0.59
60 0.58
61 0.52
62 0.48
63 0.46
64 0.4
65 0.38
66 0.4
67 0.4
68 0.44
69 0.51
70 0.56
71 0.59
72 0.69
73 0.74
74 0.77
75 0.73
76 0.68
77 0.63
78 0.58
79 0.55
80 0.55
81 0.55
82 0.55
83 0.62
84 0.59
85 0.57
86 0.56
87 0.5