Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7YQQ3

Protein Details
Accession C7YQQ3    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
377-405LEQPTARNTGKKKSKPKKKAKKEGEADAEBasic
NLS Segment(s)
PositionSequence
385-399TGKKKSKPKKKAKKE
Subcellular Location(s) cyto 16, cyto_nucl 12.833, nucl 7.5, mito_nucl 4.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR036005  Creatinase/aminopeptidase-like  
IPR047113  PA2G4/ARX1  
IPR000994  Pept_M24  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
KEGG nhe:NECHADRAFT_100138  -  
Pfam View protein in Pfam  
PF00557  Peptidase_M24  
CDD cd01089  PA2G4-like  
Amino Acid Sequences MSDNKEIDYTLANPDTLTKYKTAAQISEKVLAEVSKLVVPGAKIVDICQQGDKLIEEEIAKVYRGKKINKGFSHPTTVSPASYVTPYTPLTSDEAEAGIEIKEGEPIKIQLGAQIDGFGSIVCDTVVATPEDKAGEPVTGRTADLILANYYVNELLLRLMIPPGLLAQGTDEEKAKAAAQKAPTQSKITSLLEKVTKAYDVNLVESTTSWLFDRNEIEGSKKIVLAPAEGTKGDGTPEISEVWGVEVGVSLGSGKVKSIDQRPTLHRRTNQTYGLKRPTSRKILSEVQKKFGTFPFSLRQLEDERDAKSGVVECVRGNVFRQYELVGDKDNAQVARYLTTIAITKNGITKLGAPPPLDLEKYQSDKKIEDEEVLKILEQPTARNTGKKKSKPKKKAKKEGEADAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.27
3 0.27
4 0.28
5 0.23
6 0.24
7 0.29
8 0.36
9 0.36
10 0.36
11 0.38
12 0.43
13 0.46
14 0.5
15 0.45
16 0.39
17 0.36
18 0.3
19 0.26
20 0.2
21 0.18
22 0.13
23 0.12
24 0.12
25 0.13
26 0.13
27 0.15
28 0.15
29 0.15
30 0.13
31 0.15
32 0.21
33 0.22
34 0.23
35 0.22
36 0.21
37 0.2
38 0.22
39 0.21
40 0.15
41 0.13
42 0.14
43 0.12
44 0.13
45 0.16
46 0.15
47 0.15
48 0.18
49 0.2
50 0.25
51 0.32
52 0.36
53 0.43
54 0.52
55 0.61
56 0.63
57 0.68
58 0.69
59 0.66
60 0.7
61 0.61
62 0.54
63 0.5
64 0.46
65 0.38
66 0.3
67 0.27
68 0.2
69 0.2
70 0.18
71 0.12
72 0.14
73 0.15
74 0.16
75 0.15
76 0.15
77 0.17
78 0.17
79 0.17
80 0.14
81 0.13
82 0.11
83 0.11
84 0.1
85 0.07
86 0.06
87 0.06
88 0.05
89 0.09
90 0.09
91 0.1
92 0.11
93 0.12
94 0.12
95 0.14
96 0.14
97 0.13
98 0.15
99 0.15
100 0.14
101 0.13
102 0.12
103 0.1
104 0.11
105 0.07
106 0.05
107 0.05
108 0.05
109 0.04
110 0.04
111 0.04
112 0.05
113 0.07
114 0.07
115 0.07
116 0.07
117 0.09
118 0.1
119 0.09
120 0.1
121 0.09
122 0.09
123 0.09
124 0.1
125 0.11
126 0.11
127 0.11
128 0.1
129 0.1
130 0.09
131 0.09
132 0.09
133 0.07
134 0.07
135 0.07
136 0.07
137 0.07
138 0.06
139 0.05
140 0.04
141 0.04
142 0.04
143 0.04
144 0.04
145 0.04
146 0.05
147 0.05
148 0.04
149 0.04
150 0.04
151 0.05
152 0.04
153 0.04
154 0.04
155 0.06
156 0.07
157 0.08
158 0.08
159 0.08
160 0.09
161 0.09
162 0.1
163 0.11
164 0.12
165 0.15
166 0.17
167 0.23
168 0.27
169 0.31
170 0.32
171 0.31
172 0.3
173 0.28
174 0.31
175 0.27
176 0.24
177 0.21
178 0.23
179 0.21
180 0.21
181 0.2
182 0.15
183 0.15
184 0.12
185 0.12
186 0.13
187 0.12
188 0.13
189 0.13
190 0.12
191 0.11
192 0.11
193 0.12
194 0.08
195 0.08
196 0.07
197 0.09
198 0.09
199 0.11
200 0.13
201 0.12
202 0.14
203 0.14
204 0.16
205 0.15
206 0.17
207 0.15
208 0.15
209 0.13
210 0.13
211 0.13
212 0.12
213 0.12
214 0.12
215 0.12
216 0.12
217 0.12
218 0.1
219 0.1
220 0.1
221 0.08
222 0.07
223 0.07
224 0.08
225 0.07
226 0.07
227 0.07
228 0.06
229 0.07
230 0.06
231 0.05
232 0.04
233 0.04
234 0.04
235 0.04
236 0.03
237 0.03
238 0.03
239 0.04
240 0.04
241 0.04
242 0.06
243 0.07
244 0.12
245 0.18
246 0.25
247 0.29
248 0.35
249 0.42
250 0.5
251 0.56
252 0.58
253 0.58
254 0.59
255 0.61
256 0.62
257 0.63
258 0.62
259 0.61
260 0.62
261 0.65
262 0.61
263 0.58
264 0.59
265 0.59
266 0.59
267 0.56
268 0.5
269 0.48
270 0.53
271 0.58
272 0.61
273 0.57
274 0.54
275 0.54
276 0.51
277 0.48
278 0.42
279 0.39
280 0.3
281 0.31
282 0.31
283 0.33
284 0.35
285 0.32
286 0.32
287 0.29
288 0.31
289 0.32
290 0.28
291 0.25
292 0.25
293 0.25
294 0.21
295 0.2
296 0.19
297 0.16
298 0.16
299 0.15
300 0.14
301 0.18
302 0.19
303 0.18
304 0.18
305 0.22
306 0.21
307 0.21
308 0.22
309 0.18
310 0.2
311 0.21
312 0.21
313 0.16
314 0.16
315 0.17
316 0.18
317 0.2
318 0.18
319 0.17
320 0.18
321 0.16
322 0.17
323 0.16
324 0.15
325 0.12
326 0.13
327 0.15
328 0.13
329 0.14
330 0.13
331 0.14
332 0.18
333 0.19
334 0.18
335 0.17
336 0.2
337 0.24
338 0.3
339 0.33
340 0.29
341 0.3
342 0.34
343 0.37
344 0.35
345 0.29
346 0.28
347 0.31
348 0.36
349 0.4
350 0.4
351 0.4
352 0.39
353 0.43
354 0.44
355 0.38
356 0.37
357 0.35
358 0.32
359 0.31
360 0.3
361 0.26
362 0.22
363 0.22
364 0.2
365 0.18
366 0.18
367 0.2
368 0.28
369 0.3
370 0.35
371 0.39
372 0.46
373 0.56
374 0.64
375 0.71
376 0.74
377 0.83
378 0.87
379 0.94
380 0.94
381 0.95
382 0.96
383 0.96
384 0.96
385 0.93