Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7YNL6

Protein Details
Accession C7YNL6    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
54-74ISSAPKPRWKQLTKRRLQTWPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 11.5, cyto 6.5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR037151  AlkB-like_sf  
IPR032862  ALKBH6  
KEGG nhe:NECHADRAFT_100201  -  
Amino Acid Sequences MDASASSGHKDDAGNGFSLPPSLDHARITALPQTAYYIPDFISEEEERMILDKISSAPKPRWKQLTKRRLQTWPSDLVNNKLLDAPLPPWLETPAVSRLLSLPIQDSESGHIFTQSPHKKPNHVLINEYPPGIGIMPHKMDPRIGLSFVRKEDGALDPEPAWRILQEPRSLLITTDQLYTDYLHGIADIEEDADLSADTVANWDLLRDADAYASGRNIRQTRTSLTYRDVLKVSKVANKLGMFLKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.2
4 0.18
5 0.19
6 0.15
7 0.1
8 0.15
9 0.17
10 0.19
11 0.18
12 0.19
13 0.21
14 0.22
15 0.23
16 0.22
17 0.2
18 0.19
19 0.18
20 0.21
21 0.19
22 0.2
23 0.18
24 0.14
25 0.13
26 0.14
27 0.16
28 0.12
29 0.17
30 0.16
31 0.16
32 0.16
33 0.16
34 0.14
35 0.14
36 0.14
37 0.08
38 0.08
39 0.08
40 0.1
41 0.15
42 0.17
43 0.21
44 0.27
45 0.37
46 0.43
47 0.49
48 0.57
49 0.6
50 0.68
51 0.74
52 0.79
53 0.78
54 0.81
55 0.81
56 0.79
57 0.76
58 0.73
59 0.67
60 0.63
61 0.56
62 0.52
63 0.46
64 0.41
65 0.42
66 0.34
67 0.29
68 0.23
69 0.21
70 0.16
71 0.16
72 0.13
73 0.14
74 0.15
75 0.15
76 0.14
77 0.16
78 0.16
79 0.15
80 0.16
81 0.13
82 0.15
83 0.14
84 0.14
85 0.14
86 0.16
87 0.15
88 0.13
89 0.11
90 0.1
91 0.11
92 0.11
93 0.1
94 0.1
95 0.11
96 0.11
97 0.1
98 0.1
99 0.09
100 0.1
101 0.2
102 0.23
103 0.24
104 0.3
105 0.32
106 0.35
107 0.38
108 0.46
109 0.45
110 0.4
111 0.41
112 0.37
113 0.42
114 0.39
115 0.36
116 0.27
117 0.18
118 0.17
119 0.14
120 0.12
121 0.07
122 0.09
123 0.1
124 0.12
125 0.13
126 0.13
127 0.13
128 0.13
129 0.16
130 0.15
131 0.15
132 0.15
133 0.17
134 0.21
135 0.21
136 0.21
137 0.17
138 0.16
139 0.17
140 0.17
141 0.17
142 0.14
143 0.15
144 0.14
145 0.15
146 0.16
147 0.14
148 0.12
149 0.09
150 0.1
151 0.14
152 0.18
153 0.2
154 0.2
155 0.21
156 0.23
157 0.23
158 0.21
159 0.19
160 0.16
161 0.15
162 0.15
163 0.14
164 0.12
165 0.13
166 0.13
167 0.12
168 0.1
169 0.09
170 0.07
171 0.07
172 0.07
173 0.06
174 0.06
175 0.05
176 0.05
177 0.04
178 0.05
179 0.05
180 0.04
181 0.04
182 0.04
183 0.04
184 0.04
185 0.04
186 0.05
187 0.05
188 0.06
189 0.06
190 0.06
191 0.06
192 0.07
193 0.08
194 0.08
195 0.07
196 0.07
197 0.09
198 0.1
199 0.1
200 0.12
201 0.13
202 0.14
203 0.21
204 0.24
205 0.26
206 0.3
207 0.34
208 0.38
209 0.42
210 0.46
211 0.41
212 0.43
213 0.45
214 0.43
215 0.43
216 0.4
217 0.35
218 0.33
219 0.35
220 0.34
221 0.36
222 0.36
223 0.35
224 0.39
225 0.37
226 0.38