Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9IXI5

Protein Details
Accession A0A1B9IXI5   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
297-316ELAHLERKNKNKNGSGKARRBasic
NLS Segment(s)
PositionSequence
303-316RKNKNKNGSGKARR
Subcellular Location(s) nucl 16, cyto_nucl 12, cyto 6, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR016181  Acyl_CoA_acyltransferase  
IPR000182  GNAT_dom  
Gene Ontology GO:0016747  F:acyltransferase activity, transferring groups other than amino-acyl groups  
Pfam View protein in Pfam  
PF13302  Acetyltransf_3  
PROSITE View protein in PROSITE  
PS51186  GNAT  
CDD cd04301  NAT_SF  
Amino Acid Sequences MPEHPPSTSPSPVQQGPDGPYMQLQGNDLRLTLWKDTDVNDAVELFNHPDVGKWACLRPYPYGPKDYQFIASILPLHRDLASSFLDATPPPLGNLESCPMFPLSALRDDQGRVVGSANVGPSQKEVGAWEIAYDLHPSLQGKGIGRIMVQTLIEFTGWLGVKMVVAFCETSNIPSSSLLKKLGFTYVGEKLQQYPEDKGGDVRVIHGFNNLCTGIFPDDGESSSPILKETSAEAAKMNRFQAQSQSRASIPGSKKMKLTGTLFTVSCLYRYPDGENHQLGSYIAEQLGGRTIDIDNELAHLERKNKNKNGSGKARR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.4
3 0.39
4 0.41
5 0.36
6 0.3
7 0.28
8 0.27
9 0.25
10 0.22
11 0.19
12 0.18
13 0.2
14 0.2
15 0.19
16 0.17
17 0.19
18 0.21
19 0.21
20 0.19
21 0.18
22 0.2
23 0.21
24 0.26
25 0.25
26 0.22
27 0.2
28 0.2
29 0.18
30 0.17
31 0.16
32 0.13
33 0.11
34 0.12
35 0.11
36 0.11
37 0.14
38 0.16
39 0.18
40 0.18
41 0.21
42 0.23
43 0.26
44 0.29
45 0.32
46 0.38
47 0.45
48 0.46
49 0.49
50 0.48
51 0.48
52 0.47
53 0.43
54 0.36
55 0.28
56 0.24
57 0.19
58 0.18
59 0.18
60 0.17
61 0.18
62 0.16
63 0.15
64 0.15
65 0.15
66 0.14
67 0.14
68 0.14
69 0.12
70 0.13
71 0.12
72 0.12
73 0.11
74 0.13
75 0.12
76 0.11
77 0.1
78 0.1
79 0.11
80 0.11
81 0.13
82 0.13
83 0.12
84 0.11
85 0.12
86 0.12
87 0.11
88 0.1
89 0.11
90 0.11
91 0.13
92 0.14
93 0.13
94 0.14
95 0.15
96 0.16
97 0.15
98 0.13
99 0.1
100 0.1
101 0.1
102 0.09
103 0.1
104 0.1
105 0.1
106 0.1
107 0.1
108 0.09
109 0.1
110 0.1
111 0.09
112 0.09
113 0.09
114 0.09
115 0.09
116 0.08
117 0.07
118 0.08
119 0.08
120 0.08
121 0.06
122 0.05
123 0.07
124 0.07
125 0.07
126 0.1
127 0.11
128 0.11
129 0.13
130 0.14
131 0.13
132 0.12
133 0.12
134 0.1
135 0.09
136 0.08
137 0.06
138 0.06
139 0.06
140 0.06
141 0.05
142 0.04
143 0.07
144 0.07
145 0.07
146 0.07
147 0.07
148 0.07
149 0.08
150 0.08
151 0.04
152 0.05
153 0.05
154 0.04
155 0.07
156 0.06
157 0.08
158 0.1
159 0.1
160 0.1
161 0.11
162 0.14
163 0.14
164 0.16
165 0.18
166 0.16
167 0.16
168 0.16
169 0.17
170 0.15
171 0.14
172 0.16
173 0.17
174 0.18
175 0.18
176 0.18
177 0.18
178 0.2
179 0.22
180 0.2
181 0.18
182 0.2
183 0.21
184 0.21
185 0.19
186 0.18
187 0.17
188 0.15
189 0.15
190 0.14
191 0.14
192 0.14
193 0.17
194 0.16
195 0.14
196 0.17
197 0.15
198 0.12
199 0.11
200 0.13
201 0.11
202 0.11
203 0.11
204 0.1
205 0.1
206 0.11
207 0.12
208 0.11
209 0.1
210 0.11
211 0.11
212 0.1
213 0.1
214 0.09
215 0.09
216 0.09
217 0.15
218 0.14
219 0.15
220 0.16
221 0.2
222 0.22
223 0.25
224 0.24
225 0.23
226 0.24
227 0.24
228 0.33
229 0.34
230 0.36
231 0.36
232 0.37
233 0.33
234 0.34
235 0.34
236 0.33
237 0.3
238 0.34
239 0.37
240 0.36
241 0.38
242 0.4
243 0.42
244 0.39
245 0.4
246 0.35
247 0.34
248 0.36
249 0.34
250 0.31
251 0.3
252 0.24
253 0.22
254 0.19
255 0.18
256 0.18
257 0.2
258 0.23
259 0.27
260 0.32
261 0.39
262 0.38
263 0.37
264 0.34
265 0.33
266 0.28
267 0.24
268 0.2
269 0.14
270 0.13
271 0.12
272 0.12
273 0.12
274 0.16
275 0.13
276 0.12
277 0.12
278 0.12
279 0.12
280 0.14
281 0.14
282 0.1
283 0.11
284 0.12
285 0.11
286 0.14
287 0.16
288 0.22
289 0.29
290 0.39
291 0.48
292 0.55
293 0.63
294 0.69
295 0.75
296 0.78