Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7ZHS1

Protein Details
Accession C7ZHS1    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
4-34RAPPKPPAKKPAGKVPPRRKHQAPKSENFYRBasic
NLS Segment(s)
PositionSequence
5-28APPKPPAKKPAGKVPPRRKHQAPK
Subcellular Location(s) mito 11, nucl 10, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR042831  YmL28  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG nhe:NECHADRAFT_29356  -  
Amino Acid Sequences LLARAPPKPPAKKPAGKVPPRRKHQAPKSENFYRIRTLRQNMFSPAPPPLRMARLRYLRHWTIHRAWQLFRRQQHLAIEQERHRMYSGMYNACEELRKTVGPGNRDEGYLYRVAMEKKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.77
3 0.78
4 0.82
5 0.84
6 0.84
7 0.83
8 0.86
9 0.84
10 0.84
11 0.85
12 0.85
13 0.82
14 0.81
15 0.82
16 0.8
17 0.77
18 0.7
19 0.63
20 0.58
21 0.52
22 0.5
23 0.48
24 0.47
25 0.47
26 0.47
27 0.47
28 0.44
29 0.44
30 0.39
31 0.33
32 0.33
33 0.28
34 0.24
35 0.24
36 0.22
37 0.25
38 0.26
39 0.29
40 0.31
41 0.37
42 0.38
43 0.4
44 0.45
45 0.42
46 0.43
47 0.42
48 0.4
49 0.35
50 0.4
51 0.4
52 0.36
53 0.35
54 0.38
55 0.44
56 0.45
57 0.44
58 0.43
59 0.4
60 0.41
61 0.44
62 0.41
63 0.38
64 0.36
65 0.39
66 0.36
67 0.41
68 0.38
69 0.35
70 0.31
71 0.26
72 0.23
73 0.24
74 0.28
75 0.25
76 0.25
77 0.25
78 0.25
79 0.25
80 0.26
81 0.2
82 0.18
83 0.16
84 0.16
85 0.17
86 0.21
87 0.25
88 0.26
89 0.29
90 0.31
91 0.3
92 0.3
93 0.3
94 0.26
95 0.26
96 0.24
97 0.21
98 0.17
99 0.19