Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9IQF2

Protein Details
Accession A0A1B9IQF2    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
190-235QSQQRPNKRARTKVNGNGGGKISKVERRKKEKQKKMESGEKDRTRNHydrophilic
NLS Segment(s)
PositionSequence
195-227PNKRARTKVNGNGGGKISKVERRKKEKQKKMES
Subcellular Location(s) nucl 21.5, cyto_nucl 13.833, mito_nucl 12.166, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR018607  Ctf8  
Gene Ontology GO:0031390  C:Ctf18 RFC-like complex  
GO:0007064  P:mitotic sister chromatid cohesion  
Pfam View protein in Pfam  
PF09696  Ctf8  
Amino Acid Sequences MRIHLPLHPAQLDPPASSSSSSSSSPLIQLGGDLVLVELQGELSYEGDKSDGVIGVIGLDRPDKPTLHLGPHHLLHGKFVNLQKPYAVIRKVIGKSNSVEGTTKLEGNASNEESNEEDSSSEEEENLFGKDDEPSTPLRSKGKGVDYSSSPVYAPLTPIDYSSDLEMDPSSPARSEWDQIEHDDQEDEEQSQQRPNKRARTKVNGNGGGKISKVERRKKEKQKKMESGEKDRTRNYQVIGIVKKKVVFALRPEPLVAPTILPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.22
3 0.22
4 0.22
5 0.22
6 0.18
7 0.2
8 0.2
9 0.19
10 0.19
11 0.19
12 0.19
13 0.19
14 0.16
15 0.12
16 0.11
17 0.11
18 0.09
19 0.07
20 0.06
21 0.05
22 0.05
23 0.04
24 0.04
25 0.03
26 0.03
27 0.03
28 0.04
29 0.04
30 0.05
31 0.05
32 0.05
33 0.06
34 0.06
35 0.06
36 0.06
37 0.07
38 0.07
39 0.07
40 0.07
41 0.06
42 0.07
43 0.07
44 0.07
45 0.06
46 0.07
47 0.07
48 0.1
49 0.13
50 0.12
51 0.15
52 0.22
53 0.25
54 0.29
55 0.32
56 0.33
57 0.35
58 0.36
59 0.36
60 0.32
61 0.29
62 0.27
63 0.26
64 0.22
65 0.23
66 0.26
67 0.29
68 0.26
69 0.27
70 0.24
71 0.23
72 0.26
73 0.27
74 0.25
75 0.2
76 0.2
77 0.28
78 0.29
79 0.33
80 0.32
81 0.28
82 0.28
83 0.32
84 0.31
85 0.24
86 0.23
87 0.18
88 0.21
89 0.19
90 0.18
91 0.14
92 0.14
93 0.13
94 0.15
95 0.17
96 0.14
97 0.14
98 0.13
99 0.14
100 0.14
101 0.15
102 0.12
103 0.1
104 0.08
105 0.08
106 0.09
107 0.09
108 0.08
109 0.07
110 0.07
111 0.07
112 0.08
113 0.07
114 0.06
115 0.05
116 0.06
117 0.06
118 0.07
119 0.07
120 0.08
121 0.09
122 0.12
123 0.14
124 0.16
125 0.18
126 0.19
127 0.21
128 0.24
129 0.28
130 0.3
131 0.3
132 0.3
133 0.29
134 0.31
135 0.29
136 0.25
137 0.19
138 0.14
139 0.14
140 0.11
141 0.1
142 0.08
143 0.1
144 0.1
145 0.1
146 0.12
147 0.12
148 0.12
149 0.11
150 0.11
151 0.09
152 0.09
153 0.09
154 0.07
155 0.07
156 0.07
157 0.07
158 0.07
159 0.07
160 0.11
161 0.13
162 0.14
163 0.15
164 0.19
165 0.19
166 0.22
167 0.25
168 0.21
169 0.2
170 0.18
171 0.17
172 0.14
173 0.13
174 0.12
175 0.11
176 0.14
177 0.14
178 0.2
179 0.25
180 0.3
181 0.37
182 0.44
183 0.52
184 0.58
185 0.66
186 0.7
187 0.75
188 0.78
189 0.79
190 0.82
191 0.79
192 0.72
193 0.66
194 0.59
195 0.5
196 0.4
197 0.33
198 0.27
199 0.26
200 0.34
201 0.4
202 0.48
203 0.57
204 0.68
205 0.77
206 0.85
207 0.88
208 0.9
209 0.92
210 0.92
211 0.91
212 0.91
213 0.88
214 0.87
215 0.87
216 0.84
217 0.78
218 0.72
219 0.69
220 0.65
221 0.59
222 0.51
223 0.46
224 0.42
225 0.45
226 0.48
227 0.47
228 0.45
229 0.44
230 0.43
231 0.38
232 0.39
233 0.36
234 0.33
235 0.36
236 0.42
237 0.44
238 0.44
239 0.44
240 0.41
241 0.36
242 0.34
243 0.27