Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B9IEX7

Protein Details
Accession A0A1B9IEX7    Localization Confidence High Confidence Score 19.3
NoLS Segment(s)
PositionSequenceProtein Nature
18-44KARSPSSSTPKPKPKAAPKPKAEAKVTHydrophilic
235-260LVLPPSSQKRNVKRGKKDEEKGEAKPHydrophilic
NLS Segment(s)
PositionSequence
12-52KRSPSAKARSPSSSTPKPKPKAAPKPKAEAKVTTKAKASKK
116-123KGKGRGKK
228-272KKRKAPILVLPPSSQKRNVKRGKKDEEKGEAKPKTMTATARKGRK
Subcellular Location(s) nucl 19.5, mito_nucl 12.5, mito 4.5
Family & Domain DBs
Amino Acid Sequences MAITKSLKTYGKRSPSAKARSPSSSTPKPKPKAAPKPKAEAKVTTKAKASKKDISPTKEQTPADIQKEEEDINDDEKVKIQKIILVLMENMKNVDWFDIAKKVDLTPMTSSSNIGKGKGRGKKLGGTAGGEKMGGTELREYYQNTILPLFKKGDISSIPDIEPTKNHTNKEETSPMDVDQSMSTIPAEEGEEEQASLLSSPVPSIPADAVEEEDNVELDNEEESQFPKKRKAPILVLPPSSQKRNVKRGKKDEEKGEAKPKTMTATARKGRKEVVVQIGGKKSGDEYFSESD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.67
3 0.72
4 0.73
5 0.7
6 0.67
7 0.66
8 0.68
9 0.67
10 0.67
11 0.68
12 0.68
13 0.71
14 0.76
15 0.75
16 0.77
17 0.79
18 0.81
19 0.82
20 0.84
21 0.85
22 0.81
23 0.85
24 0.85
25 0.83
26 0.75
27 0.73
28 0.69
29 0.69
30 0.67
31 0.6
32 0.58
33 0.58
34 0.62
35 0.62
36 0.62
37 0.6
38 0.62
39 0.68
40 0.71
41 0.69
42 0.7
43 0.67
44 0.66
45 0.64
46 0.58
47 0.52
48 0.52
49 0.53
50 0.49
51 0.44
52 0.38
53 0.33
54 0.35
55 0.31
56 0.23
57 0.2
58 0.16
59 0.17
60 0.18
61 0.17
62 0.15
63 0.19
64 0.21
65 0.18
66 0.19
67 0.17
68 0.18
69 0.18
70 0.2
71 0.16
72 0.15
73 0.15
74 0.17
75 0.17
76 0.15
77 0.14
78 0.12
79 0.11
80 0.1
81 0.1
82 0.07
83 0.07
84 0.09
85 0.14
86 0.14
87 0.15
88 0.15
89 0.14
90 0.17
91 0.17
92 0.18
93 0.15
94 0.17
95 0.18
96 0.18
97 0.18
98 0.16
99 0.22
100 0.2
101 0.19
102 0.19
103 0.22
104 0.3
105 0.35
106 0.38
107 0.36
108 0.38
109 0.41
110 0.4
111 0.4
112 0.33
113 0.29
114 0.27
115 0.24
116 0.22
117 0.17
118 0.14
119 0.1
120 0.09
121 0.07
122 0.06
123 0.06
124 0.07
125 0.08
126 0.09
127 0.1
128 0.11
129 0.14
130 0.14
131 0.13
132 0.14
133 0.15
134 0.15
135 0.16
136 0.15
137 0.13
138 0.14
139 0.13
140 0.15
141 0.14
142 0.18
143 0.18
144 0.17
145 0.17
146 0.17
147 0.18
148 0.16
149 0.16
150 0.18
151 0.25
152 0.27
153 0.28
154 0.3
155 0.33
156 0.35
157 0.39
158 0.38
159 0.3
160 0.3
161 0.3
162 0.27
163 0.24
164 0.22
165 0.17
166 0.13
167 0.12
168 0.08
169 0.07
170 0.07
171 0.06
172 0.05
173 0.05
174 0.06
175 0.06
176 0.06
177 0.08
178 0.08
179 0.07
180 0.07
181 0.07
182 0.06
183 0.06
184 0.05
185 0.04
186 0.04
187 0.05
188 0.05
189 0.06
190 0.06
191 0.07
192 0.07
193 0.07
194 0.08
195 0.08
196 0.1
197 0.09
198 0.09
199 0.09
200 0.09
201 0.08
202 0.07
203 0.07
204 0.05
205 0.05
206 0.05
207 0.06
208 0.06
209 0.07
210 0.08
211 0.15
212 0.2
213 0.23
214 0.31
215 0.36
216 0.44
217 0.51
218 0.58
219 0.58
220 0.62
221 0.69
222 0.68
223 0.65
224 0.59
225 0.59
226 0.56
227 0.53
228 0.52
229 0.51
230 0.53
231 0.61
232 0.69
233 0.72
234 0.78
235 0.84
236 0.87
237 0.88
238 0.87
239 0.86
240 0.85
241 0.81
242 0.77
243 0.77
244 0.69
245 0.61
246 0.55
247 0.47
248 0.42
249 0.41
250 0.4
251 0.39
252 0.47
253 0.53
254 0.58
255 0.6
256 0.58
257 0.58
258 0.58
259 0.56
260 0.53
261 0.54
262 0.54
263 0.54
264 0.57
265 0.57
266 0.52
267 0.46
268 0.38
269 0.31
270 0.27
271 0.26
272 0.21