Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9IPC3

Protein Details
Accession A0A1B9IPC3    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
23-54AGLVKEKVKFRPRKKGKRKKCQRGIRIANTRIBasic
NLS Segment(s)
PositionSequence
27-42KEKVKFRPRKKGKRKK
Subcellular Location(s) nucl 13, mito 11, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MPQRANNHPSLQRTYQEDMRALAGLVKEKVKFRPRKKGKRKKCQRGIRIANTRIVITLSYAATSQVYHDPLRIDEAQEQAAPFLRVLRFLIHEISETLGIIIIDKCLNTVPALS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.49
3 0.47
4 0.42
5 0.36
6 0.33
7 0.29
8 0.23
9 0.2
10 0.16
11 0.15
12 0.15
13 0.17
14 0.18
15 0.21
16 0.29
17 0.37
18 0.46
19 0.51
20 0.61
21 0.69
22 0.78
23 0.87
24 0.9
25 0.91
26 0.93
27 0.96
28 0.96
29 0.95
30 0.94
31 0.92
32 0.91
33 0.9
34 0.88
35 0.86
36 0.76
37 0.7
38 0.59
39 0.5
40 0.39
41 0.3
42 0.2
43 0.11
44 0.11
45 0.07
46 0.06
47 0.06
48 0.06
49 0.06
50 0.06
51 0.07
52 0.08
53 0.11
54 0.1
55 0.12
56 0.12
57 0.12
58 0.17
59 0.15
60 0.15
61 0.15
62 0.16
63 0.16
64 0.16
65 0.16
66 0.12
67 0.13
68 0.12
69 0.1
70 0.12
71 0.11
72 0.12
73 0.13
74 0.14
75 0.15
76 0.16
77 0.18
78 0.15
79 0.16
80 0.15
81 0.16
82 0.14
83 0.11
84 0.1
85 0.09
86 0.08
87 0.08
88 0.08
89 0.08
90 0.08
91 0.08
92 0.09
93 0.09
94 0.1