Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9IFD9

Protein Details
Accession A0A1B9IFD9    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-46AHIPIVKKRTKTFKRHQSDRYHGVKESWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
9-52KKRTKTFKRHQSDRYHGVKESWRKPKGIDNRVRRRFKGQLPMPK
Subcellular Location(s) nucl 12.5, mito_nucl 12, mito 10.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MPAHIPIVKKRTKTFKRHQSDRYHGVKESWRKPKGIDNRVRRRFKGQLPMPKIGYGSNKKTKHLLPSGHKELLVHNLSELELLLMHSGKYAASIAHGVSSKKRVEIVARAKVLGVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.78
3 0.83
4 0.87
5 0.88
6 0.87
7 0.86
8 0.85
9 0.81
10 0.74
11 0.64
12 0.59
13 0.58
14 0.57
15 0.57
16 0.58
17 0.54
18 0.51
19 0.52
20 0.57
21 0.6
22 0.61
23 0.61
24 0.62
25 0.7
26 0.79
27 0.83
28 0.76
29 0.73
30 0.7
31 0.66
32 0.66
33 0.62
34 0.62
35 0.62
36 0.64
37 0.57
38 0.51
39 0.45
40 0.36
41 0.36
42 0.31
43 0.33
44 0.38
45 0.39
46 0.39
47 0.42
48 0.42
49 0.42
50 0.42
51 0.42
52 0.4
53 0.47
54 0.52
55 0.5
56 0.47
57 0.41
58 0.36
59 0.36
60 0.3
61 0.21
62 0.15
63 0.15
64 0.14
65 0.14
66 0.13
67 0.05
68 0.04
69 0.04
70 0.05
71 0.05
72 0.05
73 0.05
74 0.05
75 0.05
76 0.06
77 0.06
78 0.05
79 0.06
80 0.08
81 0.07
82 0.11
83 0.13
84 0.14
85 0.17
86 0.23
87 0.24
88 0.24
89 0.26
90 0.25
91 0.29
92 0.38
93 0.43
94 0.46
95 0.46
96 0.45