Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7Z815

Protein Details
Accession C7Z815    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
33-54VEELRKRLPRRKRPATDPPPEGBasic
NLS Segment(s)
PositionSequence
37-46RKRLPRRKRP
Subcellular Location(s) cyto 19.5, cyto_nucl 13.5, nucl 6.5
Family & Domain DBs
KEGG nhe:NECHADRAFT_79630  -  
Amino Acid Sequences MPLTPPCDPFNGIKAVTIWIQGKEDLERPPEDVEELRKRLPRRKRPATDPPPEGECIPVALKGVALDHLEGRPLGAALIGPYTTDVIGRNSRDSRVLAGEMRVLEVFHLEERQTETRDLTRRILVASVFHSSAIALDVPSDIKTSKFPYLLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.22
4 0.24
5 0.21
6 0.18
7 0.19
8 0.19
9 0.19
10 0.2
11 0.22
12 0.22
13 0.23
14 0.23
15 0.23
16 0.23
17 0.23
18 0.22
19 0.2
20 0.25
21 0.29
22 0.31
23 0.34
24 0.38
25 0.43
26 0.5
27 0.59
28 0.62
29 0.65
30 0.73
31 0.76
32 0.8
33 0.86
34 0.87
35 0.85
36 0.77
37 0.7
38 0.61
39 0.54
40 0.46
41 0.35
42 0.25
43 0.18
44 0.14
45 0.11
46 0.09
47 0.07
48 0.07
49 0.06
50 0.07
51 0.06
52 0.06
53 0.06
54 0.06
55 0.06
56 0.07
57 0.06
58 0.06
59 0.05
60 0.05
61 0.04
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.04
70 0.04
71 0.04
72 0.05
73 0.08
74 0.12
75 0.13
76 0.17
77 0.18
78 0.19
79 0.2
80 0.2
81 0.19
82 0.17
83 0.18
84 0.15
85 0.14
86 0.16
87 0.14
88 0.14
89 0.12
90 0.1
91 0.08
92 0.08
93 0.08
94 0.07
95 0.08
96 0.07
97 0.08
98 0.14
99 0.17
100 0.18
101 0.19
102 0.2
103 0.25
104 0.32
105 0.34
106 0.32
107 0.31
108 0.3
109 0.3
110 0.29
111 0.23
112 0.2
113 0.19
114 0.19
115 0.17
116 0.16
117 0.15
118 0.13
119 0.13
120 0.12
121 0.09
122 0.06
123 0.06
124 0.07
125 0.08
126 0.09
127 0.1
128 0.09
129 0.1
130 0.14
131 0.19
132 0.24