Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B9IGI9

Protein Details
Accession A0A1B9IGI9    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
109-133NYVPSWVKRDPKRFPRSRVQPSPGSHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 9, mito 6, cyto_nucl 5.5, cyto 5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR040719  DUF5597  
IPR013529  Glyco_hydro_42_N  
IPR017853  Glycoside_hydrolase_SF  
Gene Ontology GO:0009341  C:beta-galactosidase complex  
GO:0004565  F:beta-galactosidase activity  
GO:0005975  P:carbohydrate metabolic process  
Pfam View protein in Pfam  
PF18120  DUF5597  
PF02449  Glyco_hydro_42  
Amino Acid Sequences MKFDMVPRLVNLPANRHQFVLADGTPFFLRAAELQNSSFSSAEYMSKIWPILTAQNVNLVFGPAAWEDIEPEEGKFDFEELDKLIAGARKHELKLVILWFGAWKNGMSNYVPSWVKRDPKRFPRSRVQPSPGSTSRMVEVLSPCSKSNVNADSKAFEALMDHLKLVDGEQGTVVIVQVENEVGLLGDSRDRSSTANAIFDSPVPEEVMSKLCQAAAEGSLRDLLKENIPCLGDAMWLSQSKGKSWSETFGVSVYTDELFMAYHYAKYINQVASAGQKKYNLPMFTNGWLRTSNSVPSSTAGGGAYPGEYPSGGPADSVIDIYQLFAPSLQFVSPDIYLVDYVEIFKAYKHNNQPLFVPEHRRDEYGALRIWQAIGDYDALAMGPFGIDTLDPLTSPWTKHYGLLSKVEGFILEAWQKGSLVTGFYFDRFDVGHTDLSTPKEVDMGDWHLKIERAATFGGAHPEPGYGLIIQRSDDSFLLIGEGYMVNFQSLKADAVFTGILEFDEMETVKGQPNELRKIRRLNGDEIKSGQAAVMPTLGGGPSYGDFPIAITIPGETGLALCTVYSLSDSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.44
3 0.42
4 0.4
5 0.35
6 0.34
7 0.33
8 0.26
9 0.21
10 0.2
11 0.22
12 0.21
13 0.21
14 0.19
15 0.12
16 0.12
17 0.12
18 0.18
19 0.19
20 0.21
21 0.22
22 0.24
23 0.25
24 0.26
25 0.24
26 0.18
27 0.16
28 0.15
29 0.16
30 0.16
31 0.16
32 0.15
33 0.17
34 0.17
35 0.15
36 0.15
37 0.15
38 0.19
39 0.23
40 0.25
41 0.24
42 0.3
43 0.3
44 0.29
45 0.27
46 0.23
47 0.17
48 0.14
49 0.16
50 0.09
51 0.1
52 0.1
53 0.1
54 0.1
55 0.11
56 0.14
57 0.12
58 0.12
59 0.13
60 0.13
61 0.13
62 0.12
63 0.11
64 0.1
65 0.1
66 0.12
67 0.11
68 0.12
69 0.11
70 0.11
71 0.14
72 0.16
73 0.15
74 0.17
75 0.21
76 0.25
77 0.26
78 0.29
79 0.28
80 0.26
81 0.31
82 0.29
83 0.26
84 0.2
85 0.2
86 0.18
87 0.17
88 0.17
89 0.12
90 0.11
91 0.11
92 0.12
93 0.15
94 0.14
95 0.16
96 0.16
97 0.22
98 0.23
99 0.22
100 0.26
101 0.3
102 0.38
103 0.44
104 0.53
105 0.56
106 0.66
107 0.76
108 0.8
109 0.81
110 0.83
111 0.85
112 0.86
113 0.86
114 0.81
115 0.77
116 0.72
117 0.73
118 0.65
119 0.6
120 0.5
121 0.41
122 0.36
123 0.3
124 0.26
125 0.2
126 0.19
127 0.2
128 0.22
129 0.22
130 0.22
131 0.23
132 0.24
133 0.22
134 0.27
135 0.28
136 0.29
137 0.31
138 0.32
139 0.31
140 0.31
141 0.3
142 0.24
143 0.16
144 0.12
145 0.12
146 0.15
147 0.13
148 0.13
149 0.12
150 0.12
151 0.12
152 0.12
153 0.13
154 0.09
155 0.08
156 0.08
157 0.08
158 0.08
159 0.08
160 0.08
161 0.04
162 0.04
163 0.04
164 0.04
165 0.04
166 0.04
167 0.04
168 0.04
169 0.03
170 0.03
171 0.03
172 0.03
173 0.05
174 0.06
175 0.07
176 0.08
177 0.09
178 0.1
179 0.12
180 0.16
181 0.15
182 0.17
183 0.17
184 0.18
185 0.17
186 0.17
187 0.17
188 0.13
189 0.12
190 0.1
191 0.1
192 0.09
193 0.1
194 0.12
195 0.11
196 0.11
197 0.1
198 0.1
199 0.1
200 0.09
201 0.09
202 0.08
203 0.09
204 0.09
205 0.09
206 0.11
207 0.11
208 0.11
209 0.12
210 0.11
211 0.14
212 0.15
213 0.15
214 0.15
215 0.15
216 0.15
217 0.14
218 0.13
219 0.1
220 0.09
221 0.1
222 0.1
223 0.1
224 0.1
225 0.13
226 0.13
227 0.13
228 0.18
229 0.17
230 0.18
231 0.19
232 0.21
233 0.19
234 0.2
235 0.19
236 0.14
237 0.14
238 0.11
239 0.1
240 0.08
241 0.07
242 0.06
243 0.06
244 0.05
245 0.05
246 0.04
247 0.06
248 0.05
249 0.05
250 0.06
251 0.07
252 0.07
253 0.09
254 0.13
255 0.12
256 0.12
257 0.12
258 0.12
259 0.18
260 0.21
261 0.2
262 0.17
263 0.19
264 0.19
265 0.23
266 0.27
267 0.22
268 0.2
269 0.22
270 0.23
271 0.24
272 0.28
273 0.25
274 0.22
275 0.21
276 0.21
277 0.19
278 0.18
279 0.18
280 0.14
281 0.15
282 0.14
283 0.14
284 0.15
285 0.12
286 0.12
287 0.09
288 0.08
289 0.07
290 0.07
291 0.06
292 0.05
293 0.05
294 0.04
295 0.04
296 0.04
297 0.05
298 0.06
299 0.05
300 0.05
301 0.05
302 0.06
303 0.06
304 0.06
305 0.05
306 0.05
307 0.05
308 0.06
309 0.07
310 0.06
311 0.05
312 0.05
313 0.06
314 0.06
315 0.06
316 0.06
317 0.05
318 0.06
319 0.08
320 0.07
321 0.08
322 0.07
323 0.07
324 0.07
325 0.07
326 0.07
327 0.05
328 0.05
329 0.05
330 0.05
331 0.05
332 0.06
333 0.11
334 0.13
335 0.21
336 0.27
337 0.35
338 0.38
339 0.39
340 0.4
341 0.38
342 0.42
343 0.38
344 0.38
345 0.34
346 0.39
347 0.39
348 0.38
349 0.36
350 0.33
351 0.33
352 0.29
353 0.27
354 0.21
355 0.2
356 0.19
357 0.18
358 0.15
359 0.11
360 0.07
361 0.07
362 0.06
363 0.06
364 0.05
365 0.05
366 0.05
367 0.05
368 0.04
369 0.03
370 0.02
371 0.02
372 0.02
373 0.03
374 0.02
375 0.03
376 0.05
377 0.05
378 0.05
379 0.06
380 0.09
381 0.11
382 0.12
383 0.14
384 0.17
385 0.18
386 0.2
387 0.25
388 0.28
389 0.29
390 0.33
391 0.32
392 0.29
393 0.28
394 0.26
395 0.21
396 0.16
397 0.13
398 0.12
399 0.11
400 0.1
401 0.1
402 0.11
403 0.11
404 0.1
405 0.11
406 0.08
407 0.08
408 0.08
409 0.1
410 0.1
411 0.11
412 0.12
413 0.11
414 0.11
415 0.1
416 0.11
417 0.12
418 0.13
419 0.15
420 0.14
421 0.16
422 0.18
423 0.2
424 0.21
425 0.19
426 0.16
427 0.16
428 0.16
429 0.15
430 0.16
431 0.2
432 0.22
433 0.22
434 0.22
435 0.22
436 0.23
437 0.22
438 0.21
439 0.16
440 0.14
441 0.14
442 0.14
443 0.14
444 0.15
445 0.2
446 0.17
447 0.16
448 0.14
449 0.14
450 0.13
451 0.13
452 0.12
453 0.08
454 0.09
455 0.11
456 0.11
457 0.12
458 0.13
459 0.13
460 0.15
461 0.14
462 0.14
463 0.12
464 0.11
465 0.11
466 0.1
467 0.08
468 0.07
469 0.07
470 0.06
471 0.07
472 0.07
473 0.06
474 0.07
475 0.07
476 0.08
477 0.09
478 0.1
479 0.1
480 0.1
481 0.1
482 0.12
483 0.12
484 0.09
485 0.09
486 0.08
487 0.07
488 0.07
489 0.07
490 0.05
491 0.07
492 0.07
493 0.08
494 0.09
495 0.1
496 0.14
497 0.15
498 0.16
499 0.19
500 0.27
501 0.36
502 0.43
503 0.49
504 0.52
505 0.61
506 0.66
507 0.71
508 0.68
509 0.68
510 0.7
511 0.67
512 0.64
513 0.57
514 0.54
515 0.44
516 0.39
517 0.3
518 0.22
519 0.18
520 0.15
521 0.13
522 0.09
523 0.09
524 0.1
525 0.09
526 0.07
527 0.06
528 0.07
529 0.07
530 0.09
531 0.09
532 0.08
533 0.08
534 0.09
535 0.11
536 0.1
537 0.1
538 0.09
539 0.09
540 0.09
541 0.09
542 0.09
543 0.06
544 0.06
545 0.06
546 0.07
547 0.06
548 0.06
549 0.06
550 0.06
551 0.06