Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9J2E4

Protein Details
Accession A0A1B9J2E4    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-54APPHLSPRDRERDRRYGRDERDEDRARTRSRSRSPRRDRDRYDDRDRKYBasic
263-284GVAKVNKQRSWRQYMNRRGGFNHydrophilic
NLS Segment(s)
PositionSequence
15-46RERDRRYGRDERDEDRARTRSRSRSPRRDRDR
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013957  SNRNP27  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF08648  SNRNP27  
Amino Acid Sequences MSSRAAPPHLSPRDRERDRRYGRDERDEDRARTRSRSRSPRRDRDRYDDRDRKYGRDSGRSGYRDDRSRRDYDSPRDRDRDGRSDRDDYTRDDRRGDYTRDSRRDDHSRGDSKPDVTSRGGYSRDNPNNDPTYRPSPRPYEDRPPAGSAPSIPPSQPRAGSSAQPGFRGGYGGYGNRGGDYDIPLDRRAIEEGRRRREEERAKGVVYTEDGAYNPSAEASPAPKEEPEDELDLDDPEAQMAAMMGFGGFGTSKGKGKEDNVDGVAKVNKQRSWRQYMNRRGGFNRPLDKIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.73
3 0.71
4 0.73
5 0.79
6 0.83
7 0.82
8 0.81
9 0.81
10 0.82
11 0.78
12 0.71
13 0.72
14 0.69
15 0.64
16 0.62
17 0.62
18 0.55
19 0.58
20 0.62
21 0.62
22 0.66
23 0.73
24 0.76
25 0.8
26 0.87
27 0.9
28 0.92
29 0.93
30 0.9
31 0.88
32 0.88
33 0.85
34 0.86
35 0.83
36 0.78
37 0.77
38 0.72
39 0.67
40 0.62
41 0.6
42 0.55
43 0.55
44 0.53
45 0.5
46 0.56
47 0.53
48 0.52
49 0.52
50 0.52
51 0.52
52 0.55
53 0.57
54 0.54
55 0.56
56 0.57
57 0.59
58 0.6
59 0.61
60 0.66
61 0.66
62 0.67
63 0.67
64 0.64
65 0.63
66 0.61
67 0.61
68 0.56
69 0.56
70 0.54
71 0.54
72 0.54
73 0.52
74 0.48
75 0.43
76 0.45
77 0.45
78 0.42
79 0.4
80 0.39
81 0.39
82 0.42
83 0.41
84 0.41
85 0.42
86 0.49
87 0.53
88 0.57
89 0.54
90 0.56
91 0.6
92 0.55
93 0.53
94 0.52
95 0.51
96 0.48
97 0.51
98 0.46
99 0.39
100 0.4
101 0.34
102 0.29
103 0.25
104 0.26
105 0.21
106 0.23
107 0.23
108 0.2
109 0.23
110 0.3
111 0.34
112 0.36
113 0.36
114 0.37
115 0.4
116 0.4
117 0.38
118 0.33
119 0.36
120 0.36
121 0.37
122 0.36
123 0.37
124 0.4
125 0.44
126 0.44
127 0.46
128 0.47
129 0.49
130 0.46
131 0.44
132 0.41
133 0.35
134 0.29
135 0.21
136 0.18
137 0.17
138 0.15
139 0.12
140 0.14
141 0.17
142 0.19
143 0.19
144 0.17
145 0.19
146 0.2
147 0.21
148 0.24
149 0.26
150 0.25
151 0.24
152 0.24
153 0.2
154 0.19
155 0.18
156 0.13
157 0.1
158 0.1
159 0.1
160 0.1
161 0.11
162 0.11
163 0.1
164 0.1
165 0.08
166 0.08
167 0.09
168 0.1
169 0.11
170 0.12
171 0.13
172 0.13
173 0.13
174 0.13
175 0.14
176 0.14
177 0.2
178 0.27
179 0.36
180 0.44
181 0.48
182 0.5
183 0.5
184 0.58
185 0.6
186 0.6
187 0.6
188 0.54
189 0.51
190 0.49
191 0.47
192 0.38
193 0.29
194 0.22
195 0.14
196 0.11
197 0.1
198 0.11
199 0.11
200 0.1
201 0.08
202 0.07
203 0.07
204 0.07
205 0.08
206 0.09
207 0.12
208 0.13
209 0.14
210 0.14
211 0.17
212 0.18
213 0.2
214 0.2
215 0.2
216 0.19
217 0.19
218 0.19
219 0.17
220 0.16
221 0.13
222 0.1
223 0.07
224 0.07
225 0.05
226 0.05
227 0.04
228 0.04
229 0.03
230 0.03
231 0.03
232 0.03
233 0.03
234 0.03
235 0.03
236 0.04
237 0.07
238 0.09
239 0.13
240 0.15
241 0.18
242 0.21
243 0.25
244 0.33
245 0.35
246 0.38
247 0.37
248 0.37
249 0.35
250 0.35
251 0.35
252 0.3
253 0.32
254 0.33
255 0.34
256 0.4
257 0.49
258 0.54
259 0.6
260 0.66
261 0.7
262 0.75
263 0.82
264 0.86
265 0.83
266 0.8
267 0.74
268 0.74
269 0.71
270 0.7
271 0.67