Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7Z016

Protein Details
Accession C7Z016   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
19-70LACVLCQQRKKKCDRKSPCSFCIKAKVTCIPSTPAPKRKRRKPTKELLERLEHydrophilic
NLS Segment(s)
PositionSequence
54-63PKRKRRKPTK
Subcellular Location(s) nucl 21, cyto_nucl 13.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
KEGG nhe:NECHADRAFT_84217  -  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MAALPTEQPSRPTESKRILACVLCQQRKKKCDRKSPCSFCIKAKVTCIPSTPAPKRKRRKPTKELLERLERCEQLLKRCTCVQKSQMYDMPGHYSESSSSPTDSHSSPPPEYEKVTPSSYEQHQTFSPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.53
3 0.53
4 0.54
5 0.5
6 0.45
7 0.42
8 0.43
9 0.46
10 0.47
11 0.52
12 0.56
13 0.61
14 0.68
15 0.76
16 0.76
17 0.76
18 0.8
19 0.84
20 0.85
21 0.87
22 0.87
23 0.84
24 0.83
25 0.75
26 0.68
27 0.67
28 0.62
29 0.53
30 0.49
31 0.48
32 0.42
33 0.42
34 0.39
35 0.32
36 0.32
37 0.38
38 0.42
39 0.45
40 0.5
41 0.58
42 0.67
43 0.73
44 0.8
45 0.83
46 0.86
47 0.86
48 0.88
49 0.89
50 0.89
51 0.84
52 0.78
53 0.77
54 0.68
55 0.63
56 0.57
57 0.46
58 0.36
59 0.38
60 0.34
61 0.31
62 0.39
63 0.35
64 0.34
65 0.39
66 0.43
67 0.4
68 0.44
69 0.43
70 0.42
71 0.44
72 0.46
73 0.44
74 0.41
75 0.39
76 0.34
77 0.33
78 0.26
79 0.25
80 0.2
81 0.17
82 0.16
83 0.17
84 0.19
85 0.15
86 0.15
87 0.13
88 0.16
89 0.18
90 0.18
91 0.2
92 0.24
93 0.28
94 0.28
95 0.32
96 0.34
97 0.34
98 0.37
99 0.37
100 0.34
101 0.33
102 0.35
103 0.32
104 0.31
105 0.34
106 0.35
107 0.4
108 0.36
109 0.35