Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9J327

Protein Details
Accession A0A1B9J327    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
11-34VGYYLYKEKKDRKERKLHGKDTSGBasic
84-111SNENDSKAPKSKNKRRSRFFRKPLSLEEHydrophilic
NLS Segment(s)
PositionSequence
19-26KKDRKERK
90-105KAPKSKNKRRSRFFRK
Subcellular Location(s) nucl 12.5mito_nucl 12.5, mito 11.5
Family & Domain DBs
Amino Acid Sequences MASLIVLSGVVGYYLYKEKKDRKERKLHGKDTSGMTSPAIATSIATRQNKLGKSEHYEEIPPTYQNALISPPAQYAHEPSYGSSNENDSKAPKSKNKRRSRFFRKPLSLEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.18
4 0.26
5 0.35
6 0.46
7 0.57
8 0.66
9 0.7
10 0.79
11 0.86
12 0.9
13 0.91
14 0.88
15 0.84
16 0.79
17 0.72
18 0.65
19 0.59
20 0.48
21 0.38
22 0.31
23 0.23
24 0.19
25 0.15
26 0.11
27 0.07
28 0.06
29 0.06
30 0.09
31 0.16
32 0.16
33 0.17
34 0.19
35 0.25
36 0.26
37 0.29
38 0.29
39 0.25
40 0.3
41 0.34
42 0.32
43 0.28
44 0.27
45 0.24
46 0.24
47 0.22
48 0.16
49 0.13
50 0.12
51 0.12
52 0.11
53 0.11
54 0.1
55 0.1
56 0.1
57 0.1
58 0.1
59 0.1
60 0.11
61 0.11
62 0.13
63 0.14
64 0.16
65 0.16
66 0.16
67 0.2
68 0.19
69 0.2
70 0.18
71 0.2
72 0.2
73 0.21
74 0.22
75 0.2
76 0.25
77 0.31
78 0.37
79 0.42
80 0.5
81 0.6
82 0.69
83 0.78
84 0.83
85 0.87
86 0.91
87 0.92
88 0.92
89 0.92
90 0.93
91 0.91