Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B9IS91

Protein Details
Accession A0A1B9IS91    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
19-38RGVRSPPKRIRVRLERKRNDBasic
NLS Segment(s)
PositionSequence
22-36RSPPKRIRVRLERKR
Subcellular Location(s) mito 15, cyto 7, nucl 4, cyto_pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000054  Ribosomal_L31e  
IPR020052  Ribosomal_L31e_CS  
IPR023621  Ribosomal_L31e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01198  Ribosomal_L31e  
PROSITE View protein in PROSITE  
PS01144  RIBOSOMAL_L31E  
Amino Acid Sequences MGVNDVRISPGLNQAVWARGVRSPPKRIRVRLERKRNDDEGAKEKLYVLASVVEGVTSFKGLQTVVVEGDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.2
4 0.19
5 0.14
6 0.15
7 0.2
8 0.27
9 0.33
10 0.4
11 0.46
12 0.55
13 0.61
14 0.65
15 0.69
16 0.71
17 0.76
18 0.77
19 0.81
20 0.8
21 0.79
22 0.79
23 0.72
24 0.64
25 0.57
26 0.52
27 0.46
28 0.42
29 0.35
30 0.29
31 0.27
32 0.26
33 0.23
34 0.17
35 0.13
36 0.09
37 0.09
38 0.09
39 0.09
40 0.06
41 0.06
42 0.07
43 0.06
44 0.06
45 0.06
46 0.06
47 0.07
48 0.07
49 0.09
50 0.1
51 0.11