Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9IUQ6

Protein Details
Accession A0A1B9IUQ6    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
24-49KPSSSSTKTKTKTKPKEEKPVAKYLPHydrophilic
NLS Segment(s)
PositionSequence
119-134RKSVGADTKGKAKKGK
Subcellular Location(s) nucl 13, mito_nucl 12.999, mito 11.5, cyto_nucl 8.833
Family & Domain DBs
Amino Acid Sequences MTRTRASGGTSPSKTIKETLGLSKPSSSSTKTKTKTKPKEEKPVAKYLPTSSEFMDTAESLKVQVGESIHLEAPKKLMSTGSFGWSGSKNGSVSLKNGKKVDVSISINVVVQNSSPSKRKSVGADTKGKAKKGKVIRYHSSSSSSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.36
3 0.32
4 0.27
5 0.29
6 0.32
7 0.35
8 0.36
9 0.35
10 0.35
11 0.34
12 0.33
13 0.32
14 0.29
15 0.29
16 0.34
17 0.42
18 0.45
19 0.54
20 0.61
21 0.69
22 0.76
23 0.8
24 0.84
25 0.83
26 0.89
27 0.89
28 0.89
29 0.84
30 0.83
31 0.74
32 0.65
33 0.58
34 0.48
35 0.44
36 0.36
37 0.32
38 0.23
39 0.23
40 0.21
41 0.19
42 0.18
43 0.12
44 0.11
45 0.1
46 0.09
47 0.07
48 0.07
49 0.07
50 0.06
51 0.08
52 0.07
53 0.07
54 0.08
55 0.09
56 0.09
57 0.1
58 0.11
59 0.09
60 0.1
61 0.1
62 0.09
63 0.08
64 0.09
65 0.09
66 0.12
67 0.13
68 0.14
69 0.14
70 0.14
71 0.15
72 0.15
73 0.15
74 0.12
75 0.13
76 0.11
77 0.12
78 0.15
79 0.14
80 0.16
81 0.25
82 0.28
83 0.3
84 0.31
85 0.31
86 0.29
87 0.29
88 0.3
89 0.27
90 0.26
91 0.23
92 0.23
93 0.23
94 0.22
95 0.21
96 0.18
97 0.12
98 0.09
99 0.11
100 0.13
101 0.16
102 0.21
103 0.24
104 0.28
105 0.3
106 0.34
107 0.36
108 0.44
109 0.51
110 0.53
111 0.6
112 0.58
113 0.65
114 0.66
115 0.65
116 0.6
117 0.53
118 0.54
119 0.55
120 0.63
121 0.62
122 0.67
123 0.71
124 0.73
125 0.75
126 0.69