Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B9IJA0

Protein Details
Accession A0A1B9IJA0    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
14-40TPSPSPSPPITPKKPKAKKGINTTSPPHydrophilic
NLS Segment(s)
PositionSequence
25-33PKKPKAKKG
Subcellular Location(s) nucl 17, mito_nucl 13.333, cyto_nucl 9.833, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001005  SANT/Myb  
PROSITE View protein in PROSITE  
PS50090  MYB_LIKE  
Amino Acid Sequences MSQTVKRSLSSSPTPSPSPSPPITPKKPKAKKGINTTSPPKQSPRTKSTTQSSWTNEKENAFIKRLVETGYKNMDWKSLAEETQMTEEQCKNQLTPGRSNLRKTILDMFK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.45
3 0.46
4 0.43
5 0.43
6 0.38
7 0.39
8 0.44
9 0.51
10 0.58
11 0.63
12 0.69
13 0.73
14 0.8
15 0.82
16 0.83
17 0.84
18 0.83
19 0.83
20 0.85
21 0.81
22 0.79
23 0.77
24 0.74
25 0.68
26 0.62
27 0.56
28 0.54
29 0.55
30 0.55
31 0.56
32 0.54
33 0.54
34 0.58
35 0.58
36 0.55
37 0.5
38 0.49
39 0.46
40 0.46
41 0.44
42 0.4
43 0.37
44 0.32
45 0.31
46 0.29
47 0.27
48 0.23
49 0.22
50 0.2
51 0.19
52 0.19
53 0.19
54 0.18
55 0.16
56 0.19
57 0.22
58 0.22
59 0.22
60 0.22
61 0.22
62 0.19
63 0.18
64 0.19
65 0.17
66 0.16
67 0.16
68 0.17
69 0.16
70 0.19
71 0.2
72 0.16
73 0.17
74 0.19
75 0.2
76 0.24
77 0.24
78 0.21
79 0.25
80 0.31
81 0.32
82 0.38
83 0.44
84 0.5
85 0.54
86 0.58
87 0.58
88 0.58
89 0.55
90 0.52