Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1A0H8T8

Protein Details
Accession A0A1A0H8T8    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
10-35SDDGWKVQGRKRRNSRKRPERSVIMAHydrophilic
NLS Segment(s)
PositionSequence
18-29GRKRRNSRKRPE
Subcellular Location(s) nucl 16, cyto_nucl 12.166, mito_nucl 10.166, cyto 7, cyto_mito 5.666
Family & Domain DBs
Amino Acid Sequences MSDTLVSNISDDGWKVQGRKRRNSRKRPERSVIMATTTGSILTDQKGSLGSTPSMKNTSSNLNPFLVLAEISEEDFQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.23
4 0.3
5 0.37
6 0.47
7 0.56
8 0.64
9 0.73
10 0.81
11 0.88
12 0.91
13 0.93
14 0.92
15 0.88
16 0.83
17 0.77
18 0.71
19 0.61
20 0.52
21 0.41
22 0.32
23 0.25
24 0.19
25 0.13
26 0.08
27 0.07
28 0.06
29 0.06
30 0.06
31 0.06
32 0.06
33 0.07
34 0.07
35 0.08
36 0.09
37 0.1
38 0.13
39 0.14
40 0.17
41 0.18
42 0.18
43 0.19
44 0.19
45 0.26
46 0.28
47 0.31
48 0.31
49 0.3
50 0.29
51 0.28
52 0.26
53 0.19
54 0.14
55 0.1
56 0.09
57 0.09