Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1A0H592

Protein Details
Accession A0A1A0H592    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
83-109EAEARRSKNRAARERRQQRVEEKRQAFHydrophilic
NLS Segment(s)
PositionSequence
76-100REKSLKEEAEARRSKNRAARERRQQ
Subcellular Location(s) mito 15.5, nucl 10, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR035970  60S_ribosomal_L19/L19e_sf  
IPR000196  Ribosomal_L19/L19e  
IPR039547  RPL19  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01280  Ribosomal_L19e  
Amino Acid Sequences MGYGKRKGTKDARMPSQVVWMRRLRVLRRLLAKYRDAGKIDKSLYHSLYLSAKGNTFKHKRALVEHIIQAKAEAAREKSLKEEAEARRSKNRAARERRQQRVEEKRQAFLNDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.6
3 0.61
4 0.56
5 0.48
6 0.45
7 0.41
8 0.38
9 0.4
10 0.46
11 0.4
12 0.44
13 0.47
14 0.47
15 0.51
16 0.55
17 0.58
18 0.57
19 0.55
20 0.51
21 0.5
22 0.49
23 0.43
24 0.38
25 0.34
26 0.34
27 0.33
28 0.31
29 0.3
30 0.29
31 0.28
32 0.27
33 0.24
34 0.2
35 0.2
36 0.2
37 0.16
38 0.14
39 0.14
40 0.16
41 0.18
42 0.24
43 0.26
44 0.27
45 0.31
46 0.34
47 0.34
48 0.34
49 0.39
50 0.36
51 0.35
52 0.36
53 0.34
54 0.32
55 0.3
56 0.26
57 0.21
58 0.17
59 0.14
60 0.13
61 0.11
62 0.15
63 0.17
64 0.17
65 0.18
66 0.22
67 0.21
68 0.2
69 0.27
70 0.28
71 0.37
72 0.41
73 0.42
74 0.47
75 0.49
76 0.53
77 0.51
78 0.56
79 0.57
80 0.63
81 0.69
82 0.72
83 0.81
84 0.84
85 0.85
86 0.82
87 0.82
88 0.83
89 0.84
90 0.83
91 0.76
92 0.71
93 0.69