Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1A0H749

Protein Details
Accession A0A1A0H749    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
26-63RQQSTNKRRTQETKKRKKKKNKQRKKQTSQRNKPEDERBasic
NLS Segment(s)
PositionSequence
31-59NKRRTQETKKRKKKKNKQRKKQTSQRNKP
71-125KERTRTIKARPLKARPLKARTLKTPTLKTRPLKARTLKARTLKARTLKARTLKAR
Subcellular Location(s) nucl 12.5, mito 12, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences MGLYRRTVLSETVCVAARKPSASSPRQQSTNKRRTQETKKRKKKKNKQRKKQTSQRNKPEDERTQMNQLNKERTRTIKARPLKARPLKARTLKTPTLKTRPLKARTLKARTLKARTLKARTLKARTIKSTNIKNTTIKNTTIKNTNIKKTPTLKKHQH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.24
4 0.23
5 0.22
6 0.22
7 0.27
8 0.33
9 0.38
10 0.45
11 0.49
12 0.53
13 0.59
14 0.64
15 0.67
16 0.7
17 0.75
18 0.74
19 0.7
20 0.71
21 0.73
22 0.78
23 0.79
24 0.79
25 0.8
26 0.84
27 0.9
28 0.93
29 0.95
30 0.95
31 0.95
32 0.95
33 0.95
34 0.95
35 0.96
36 0.97
37 0.96
38 0.95
39 0.95
40 0.95
41 0.94
42 0.94
43 0.9
44 0.83
45 0.79
46 0.78
47 0.72
48 0.66
49 0.6
50 0.52
51 0.51
52 0.5
53 0.47
54 0.44
55 0.42
56 0.46
57 0.42
58 0.43
59 0.38
60 0.38
61 0.41
62 0.38
63 0.4
64 0.4
65 0.45
66 0.5
67 0.55
68 0.57
69 0.61
70 0.64
71 0.67
72 0.66
73 0.65
74 0.65
75 0.65
76 0.64
77 0.6
78 0.6
79 0.58
80 0.57
81 0.59
82 0.58
83 0.58
84 0.62
85 0.59
86 0.61
87 0.64
88 0.62
89 0.63
90 0.62
91 0.64
92 0.66
93 0.7
94 0.68
95 0.66
96 0.69
97 0.68
98 0.68
99 0.65
100 0.63
101 0.64
102 0.64
103 0.63
104 0.62
105 0.62
106 0.64
107 0.64
108 0.64
109 0.63
110 0.64
111 0.65
112 0.64
113 0.62
114 0.62
115 0.63
116 0.66
117 0.67
118 0.65
119 0.62
120 0.6
121 0.61
122 0.61
123 0.57
124 0.52
125 0.49
126 0.48
127 0.49
128 0.52
129 0.52
130 0.53
131 0.58
132 0.62
133 0.63
134 0.62
135 0.65
136 0.68
137 0.73
138 0.73