Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1A0HBD8

Protein Details
Accession A0A1A0HBD8   
Localization Confidence High
Confidence Score 17.4
NoLS Segment(s)
PositionSequenceProtein Nature
215-236DTLNKLLKRRANKTREKEDDDEHydrophilic
NLS Segment(s)
PositionSequence
108-126PKKRVSVKLKIPRRAAPKK
193-202RKAENARKRA
220-226LLKRRAN
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029523  INO80B/Ies2  
IPR006880  INO80B_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF04795  PAPA-1  
Amino Acid Sequences MSARRSRQKIAYSDDDDFDAAPPQNASDSDDASEPEFDEDPEDFDDFEDEDHQPQEAEDSAEEAYEAEPKVSARPLRGGRPVRETKKRQLTFYEEDDLLDSDEEAPAPKKRVSVKLKIPRRAAPKKEEDFLEPEPEYRPDVLRMTERQRARLAEDEPNEKYEELMFARMDEQLLALNRKTQKKKETAEEIAVRKAENARKRADYKIKQLEEEKRDTLNKLLKRRANKTREKEDDDESDSKQTLKPRRPVVGHAALMRWVSLSAGSVLAFTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.48
3 0.41
4 0.34
5 0.27
6 0.22
7 0.17
8 0.15
9 0.14
10 0.13
11 0.15
12 0.15
13 0.17
14 0.15
15 0.16
16 0.16
17 0.17
18 0.17
19 0.17
20 0.17
21 0.14
22 0.14
23 0.13
24 0.12
25 0.13
26 0.13
27 0.13
28 0.15
29 0.15
30 0.12
31 0.12
32 0.13
33 0.1
34 0.11
35 0.12
36 0.11
37 0.12
38 0.12
39 0.12
40 0.11
41 0.11
42 0.12
43 0.1
44 0.1
45 0.08
46 0.09
47 0.09
48 0.09
49 0.09
50 0.08
51 0.07
52 0.09
53 0.09
54 0.07
55 0.08
56 0.09
57 0.11
58 0.15
59 0.17
60 0.16
61 0.24
62 0.28
63 0.33
64 0.42
65 0.46
66 0.45
67 0.53
68 0.6
69 0.61
70 0.67
71 0.68
72 0.69
73 0.73
74 0.73
75 0.66
76 0.62
77 0.61
78 0.56
79 0.53
80 0.48
81 0.36
82 0.34
83 0.32
84 0.26
85 0.19
86 0.14
87 0.1
88 0.06
89 0.06
90 0.06
91 0.06
92 0.07
93 0.09
94 0.12
95 0.13
96 0.17
97 0.21
98 0.31
99 0.37
100 0.43
101 0.51
102 0.59
103 0.66
104 0.7
105 0.7
106 0.66
107 0.69
108 0.7
109 0.66
110 0.63
111 0.63
112 0.59
113 0.57
114 0.52
115 0.44
116 0.4
117 0.35
118 0.32
119 0.23
120 0.21
121 0.19
122 0.19
123 0.18
124 0.14
125 0.13
126 0.11
127 0.12
128 0.13
129 0.15
130 0.18
131 0.22
132 0.28
133 0.28
134 0.29
135 0.31
136 0.3
137 0.3
138 0.31
139 0.29
140 0.29
141 0.3
142 0.32
143 0.3
144 0.3
145 0.28
146 0.23
147 0.2
148 0.14
149 0.14
150 0.1
151 0.11
152 0.1
153 0.09
154 0.1
155 0.1
156 0.1
157 0.08
158 0.07
159 0.07
160 0.09
161 0.11
162 0.1
163 0.15
164 0.22
165 0.3
166 0.37
167 0.41
168 0.48
169 0.55
170 0.6
171 0.63
172 0.66
173 0.61
174 0.62
175 0.62
176 0.56
177 0.5
178 0.45
179 0.37
180 0.3
181 0.32
182 0.32
183 0.32
184 0.35
185 0.36
186 0.43
187 0.46
188 0.54
189 0.58
190 0.58
191 0.61
192 0.67
193 0.65
194 0.62
195 0.66
196 0.66
197 0.62
198 0.6
199 0.52
200 0.47
201 0.47
202 0.44
203 0.44
204 0.43
205 0.44
206 0.47
207 0.53
208 0.55
209 0.62
210 0.69
211 0.73
212 0.75
213 0.79
214 0.79
215 0.81
216 0.84
217 0.83
218 0.77
219 0.72
220 0.68
221 0.64
222 0.57
223 0.48
224 0.43
225 0.36
226 0.33
227 0.31
228 0.34
229 0.37
230 0.43
231 0.49
232 0.54
233 0.62
234 0.63
235 0.66
236 0.67
237 0.66
238 0.61
239 0.55
240 0.48
241 0.42
242 0.39
243 0.33
244 0.24
245 0.15
246 0.12
247 0.1
248 0.1
249 0.08
250 0.09
251 0.09