Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1A0HJD7

Protein Details
Accession A0A1A0HJD7    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
358-383LIATPLPPQGKNKKKKKKQNVASQPEHydrophilic
NLS Segment(s)
PositionSequence
367-375GKNKKKKKK
Subcellular Location(s) nucl 16.5, cyto_nucl 13.833, mito_nucl 9.666, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR036005  Creatinase/aminopeptidase-like  
IPR047113  PA2G4/ARX1  
IPR000994  Pept_M24  
IPR036388  WH-like_DNA-bd_sf  
Gene Ontology GO:0004177  F:aminopeptidase activity  
Pfam View protein in Pfam  
PF00557  Peptidase_M24  
CDD cd01089  PA2G4-like  
Amino Acid Sequences MSSKELESDISIANPDVVAKYKVGGNISNHAIETVRAAVKEGAKVFDLCELGDKTMTDALRSSVGKKISKGIAFPTCVNPNNIPAHCSPENSQDETNFTLKNGDVVNIMLGVQIEGYPAIIAETLVVGESADSPVTGQKADLLHSAWNASEAAIRLLKPGNKNWEITNTVDKIAKSFGTSAVQSMLSHNMEKDVLYGSKEIILNPSKEHKNQVETYVFKESEVYGLDILISTSGEGKVKKSKYRTTLHKLTGNNYSLRLKTSQDALKQFREKVTGPFPANVKIFDEPRKVRVGLIECSNHEVVLPYDIMEDKSSEFIAQYFTTVAITPEGLVKLTSPGFNDTFYRTEKKLEDEEILSLIATPLPPQGKNKKKKKKQNVASQPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.1
4 0.13
5 0.14
6 0.13
7 0.15
8 0.17
9 0.2
10 0.22
11 0.26
12 0.26
13 0.3
14 0.33
15 0.33
16 0.3
17 0.27
18 0.25
19 0.2
20 0.18
21 0.17
22 0.16
23 0.15
24 0.17
25 0.2
26 0.22
27 0.27
28 0.26
29 0.23
30 0.23
31 0.24
32 0.22
33 0.22
34 0.2
35 0.16
36 0.19
37 0.19
38 0.18
39 0.19
40 0.18
41 0.16
42 0.19
43 0.19
44 0.15
45 0.14
46 0.15
47 0.19
48 0.2
49 0.2
50 0.21
51 0.27
52 0.3
53 0.3
54 0.35
55 0.37
56 0.37
57 0.37
58 0.39
59 0.38
60 0.38
61 0.39
62 0.38
63 0.38
64 0.38
65 0.41
66 0.35
67 0.35
68 0.39
69 0.38
70 0.35
71 0.3
72 0.36
73 0.33
74 0.34
75 0.3
76 0.33
77 0.37
78 0.36
79 0.37
80 0.3
81 0.32
82 0.33
83 0.33
84 0.23
85 0.19
86 0.18
87 0.16
88 0.18
89 0.16
90 0.13
91 0.11
92 0.11
93 0.11
94 0.09
95 0.09
96 0.06
97 0.06
98 0.05
99 0.04
100 0.04
101 0.04
102 0.04
103 0.04
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.03
114 0.03
115 0.03
116 0.04
117 0.04
118 0.04
119 0.04
120 0.04
121 0.06
122 0.07
123 0.07
124 0.06
125 0.09
126 0.09
127 0.11
128 0.12
129 0.11
130 0.12
131 0.12
132 0.13
133 0.09
134 0.1
135 0.09
136 0.07
137 0.08
138 0.07
139 0.09
140 0.09
141 0.1
142 0.1
143 0.13
144 0.16
145 0.18
146 0.22
147 0.28
148 0.29
149 0.31
150 0.3
151 0.32
152 0.31
153 0.31
154 0.32
155 0.24
156 0.24
157 0.25
158 0.23
159 0.19
160 0.18
161 0.16
162 0.12
163 0.11
164 0.11
165 0.11
166 0.11
167 0.1
168 0.11
169 0.11
170 0.1
171 0.1
172 0.12
173 0.11
174 0.11
175 0.1
176 0.1
177 0.1
178 0.09
179 0.09
180 0.07
181 0.07
182 0.08
183 0.08
184 0.07
185 0.11
186 0.11
187 0.1
188 0.13
189 0.15
190 0.15
191 0.17
192 0.23
193 0.23
194 0.24
195 0.29
196 0.28
197 0.31
198 0.31
199 0.35
200 0.33
201 0.31
202 0.33
203 0.33
204 0.3
205 0.24
206 0.24
207 0.19
208 0.15
209 0.15
210 0.13
211 0.07
212 0.07
213 0.07
214 0.06
215 0.06
216 0.05
217 0.04
218 0.03
219 0.04
220 0.05
221 0.07
222 0.08
223 0.11
224 0.18
225 0.23
226 0.29
227 0.35
228 0.42
229 0.48
230 0.56
231 0.63
232 0.65
233 0.69
234 0.69
235 0.68
236 0.63
237 0.58
238 0.57
239 0.5
240 0.42
241 0.36
242 0.34
243 0.28
244 0.29
245 0.27
246 0.21
247 0.2
248 0.26
249 0.28
250 0.3
251 0.37
252 0.39
253 0.45
254 0.48
255 0.48
256 0.44
257 0.43
258 0.39
259 0.37
260 0.38
261 0.37
262 0.35
263 0.36
264 0.35
265 0.37
266 0.36
267 0.32
268 0.29
269 0.25
270 0.27
271 0.3
272 0.37
273 0.34
274 0.36
275 0.4
276 0.37
277 0.35
278 0.37
279 0.35
280 0.31
281 0.34
282 0.34
283 0.3
284 0.35
285 0.34
286 0.27
287 0.23
288 0.2
289 0.15
290 0.14
291 0.13
292 0.08
293 0.1
294 0.11
295 0.12
296 0.11
297 0.11
298 0.1
299 0.11
300 0.11
301 0.1
302 0.1
303 0.09
304 0.12
305 0.11
306 0.11
307 0.1
308 0.1
309 0.11
310 0.11
311 0.11
312 0.09
313 0.09
314 0.08
315 0.1
316 0.11
317 0.1
318 0.1
319 0.1
320 0.12
321 0.14
322 0.15
323 0.14
324 0.19
325 0.19
326 0.21
327 0.23
328 0.23
329 0.25
330 0.29
331 0.32
332 0.29
333 0.34
334 0.35
335 0.38
336 0.39
337 0.39
338 0.38
339 0.35
340 0.35
341 0.3
342 0.27
343 0.21
344 0.16
345 0.13
346 0.1
347 0.08
348 0.08
349 0.13
350 0.16
351 0.19
352 0.28
353 0.38
354 0.48
355 0.59
356 0.69
357 0.75
358 0.83
359 0.92
360 0.94
361 0.95
362 0.95
363 0.95